BLASTX nr result
ID: Astragalus22_contig00021644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021644 (693 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU30014.1| hypothetical protein TSUD_160990 [Trifolium subt... 59 2e-07 gb|PNT46216.1| hypothetical protein POPTR_003G179300v3 [Populus ... 57 6e-07 gb|PNX57966.1| ribonuclease H [Trifolium pratense] 57 2e-06 gb|KHN40157.1| hypothetical protein glysoja_028778, partial [Gly... 55 2e-06 dbj|GAU16251.1| hypothetical protein TSUD_298830 [Trifolium subt... 55 4e-06 gb|PNX82170.1| resistance protein PRG, partial [Trifolium pratense] 53 7e-06 >dbj|GAU30014.1| hypothetical protein TSUD_160990 [Trifolium subterraneum] Length = 168 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +2 Query: 290 WVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQADALGLPFVR 454 W+V + H R N CAD LAK G++ES A V +D PP + L ADALG+ F R Sbjct: 113 WIVAVIHTLREGNACADVLAKMGSSESSAQVVLDEPPPQLSSALHADALGVAFAR 167 >gb|PNT46216.1| hypothetical protein POPTR_003G179300v3 [Populus trichocarpa] Length = 104 Score = 56.6 bits (135), Expect = 6e-07 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = +2 Query: 290 WVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQADALGLPFVR 454 W V+I+H FR ANFCAD++AKF + + D PP + QLL A+ +G+ F R Sbjct: 48 WTVRIEHTFRKANFCADFMAKFATSCDNGLMIWDEPPQGLQQLLLANIMGISFPR 102 >gb|PNX57966.1| ribonuclease H [Trifolium pratense] Length = 192 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +2 Query: 290 WVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQADALGLPFVR 454 W V I H R N CAD+LAK GA+ + V ++APP M +LL ADA G+ FVR Sbjct: 137 WNVSIDHTLREGNACADFLAKLGASSKSSLVILEAPPSDMSRLLLADAGGMMFVR 191 >gb|KHN40157.1| hypothetical protein glysoja_028778, partial [Glycine soja] Length = 94 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/56 (39%), Positives = 36/56 (64%) Frame = +2 Query: 287 SWVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQADALGLPFVR 454 +W V ++H R N CAD+L + G+ A++ +D+PP+ + Q L ADA+G+ F R Sbjct: 38 TWNVVLKHSLREGNLCADFLTRMGSNSGSAYLELDSPPVDLYQHLLADAMGVQFFR 93 >dbj|GAU16251.1| hypothetical protein TSUD_298830 [Trifolium subterraneum] Length = 152 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +2 Query: 290 WVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQADALGLPFVR 454 W V++ H R N CADYLAK GA S+A+ T+ PP M LL DA G F R Sbjct: 98 WRVRVVHTLRKGNVCADYLAKIGAHHSEAYSTIAIPPAGMSLLLLTDASGTLFSR 152 >gb|PNX82170.1| resistance protein PRG, partial [Trifolium pratense] Length = 70 Score = 52.8 bits (125), Expect = 7e-06 Identities = 29/69 (42%), Positives = 38/69 (55%) Frame = +2 Query: 248 EITTTSAMIASPWSWVVKIQHVFRGANFCADYLAKFGATESQAHVTVDAPPIAMLQLLQA 427 EI + ++A+ W V I H R N CAD +AK GA + V +DAPP +L L A Sbjct: 3 EIQSIRNLLANEWD--VVINHTLREGNACADVMAKLGAMSTSPLVKIDAPPRELLCPLSA 60 Query: 428 DALGLPFVR 454 DA G+ F R Sbjct: 61 DARGVVFTR 69