BLASTX nr result
ID: Astragalus22_contig00021592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021592 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35718.1| unknown [Medicago truncatula] 60 8e-10 gb|KHN17134.1| hypothetical protein glysoja_011608 [Glycine soja... 56 5e-08 >gb|AFK35718.1| unknown [Medicago truncatula] Length = 56 Score = 60.5 bits (145), Expect = 8e-10 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 313 MVPVTTYFLLFISSVFYIFWDARVVLEDLTAHQARXXXXXXXXSFHY-QLDAPIIL 149 MVP+T+YFLLFISSVFY+FWDAR++LED + + R + LD PII+ Sbjct: 1 MVPITSYFLLFISSVFYVFWDARILLEDYASQRDRLHFQSSSFGYTISHLDVPIIM 56 >gb|KHN17134.1| hypothetical protein glysoja_011608 [Glycine soja] gb|KRH34877.1| hypothetical protein GLYMA_10G211100 [Glycine max] Length = 55 Score = 55.8 bits (133), Expect = 5e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 313 MVPVTTYFLLFISSVFYIFWDARVVLEDLTAH 218 M P+TTYFL+ +SSVFY+FWDARV LE+ T H Sbjct: 1 MAPITTYFLILMSSVFYVFWDARVALEEFTVH 32