BLASTX nr result
ID: Astragalus22_contig00021512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021512 (304 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP75671.1| RanBP2-type zinc finger protein At1g67325 [Cajanu... 80 3e-16 ref|XP_013461218.1| Zn-finger, RanBP-type, containing protein [M... 73 6e-13 dbj|BAT86626.1| hypothetical protein VIGAN_04429800 [Vigna angul... 68 4e-11 >gb|KYP75671.1| RanBP2-type zinc finger protein At1g67325 [Cajanus cajan] Length = 215 Score = 80.1 bits (196), Expect = 3e-16 Identities = 40/79 (50%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = +2 Query: 8 DQNDQVCYVKHFQLANLHSLLQRLLVVHEQLCEIASIFKWKAAVKL-FKWIFWKGLTFDS 184 DQ+DQVC VK+ +LHSLLQ+L V EQLC I I KW+A VKL FKWI WK +F S Sbjct: 135 DQSDQVCCVKYIHFVSLHSLLQQLWVFREQLCNIMYILKWEAVVKLPFKWILWKSFSFAS 194 Query: 185 HYLDLFHVFCYIYLFHLFC 241 +L+ F+ I + C Sbjct: 195 FHLEPFYYTFLISSVSIHC 213 >ref|XP_013461218.1| Zn-finger, RanBP-type, containing protein [Medicago truncatula] gb|KEH35253.1| Zn-finger, RanBP-type, containing protein [Medicago truncatula] Length = 332 Score = 72.8 bits (177), Expect = 6e-13 Identities = 37/54 (68%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = +2 Query: 2 SPDQNDQVCYVKHFQLANLHSLLQRLLVVHEQLCEIASIFKWKAAVK-LFKWIF 160 SPDQN+QVCYVK FQ A LH LLQ+ LV HEQLC+I +IFK KA V LFK +F Sbjct: 278 SPDQNEQVCYVKPFQSAKLHLLLQQRLVFHEQLCDIVNIFKLKAVVMFLFKCVF 331 >dbj|BAT86626.1| hypothetical protein VIGAN_04429800 [Vigna angularis var. angularis] Length = 390 Score = 68.2 bits (165), Expect = 4e-11 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Frame = +2 Query: 2 SPDQNDQVCYVKHFQLANLHSLLQRLLVVHEQLCEIASIFKWKAAVKL-FKWIFWKGLTF 178 S DQNDQVC +K F NLH LLQ+ LV EQLC++ +IFK ++ VKL FKWI K +F Sbjct: 277 SADQNDQVCCLKCFHFVNLHLLLQQ-LVFQEQLCDMMNIFKLQSVVKLSFKWILRKSFSF 335 Query: 179 DSHYLDLFHVFCYIY 223 S +L FCY + Sbjct: 336 ASIHL---KPFCYTF 347