BLASTX nr result
ID: Astragalus22_contig00020903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020903 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU16943.1| unknown [Glycine max] >gi|255634280|gb|ACU17504.1... 81 8e-17 >gb|ACU16943.1| unknown [Glycine max] gb|ACU17504.1| unknown [Glycine max] Length = 161 Score = 81.3 bits (199), Expect = 8e-17 Identities = 41/61 (67%), Positives = 46/61 (75%) Frame = +1 Query: 202 LQKFSPRCVSVLSPLYVLPALLVHQRSQCKHTNSYDHSHRYPRFLAGTHSSSAG*FAFNI 381 LQKFSPRCVSVL PLYVL A LVHQRSQ H+ + D+S RY RFLAGTHS+ G F + Sbjct: 21 LQKFSPRCVSVLRPLYVLAAPLVHQRSQHNHSGTDDNSQRYSRFLAGTHSTGGGRFFVDA 80 Query: 382 A 384 A Sbjct: 81 A 81