BLASTX nr result
ID: Astragalus22_contig00020856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020856 (310 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB41192.1| type I chlorophyll a/b-binding protein b, partia... 138 8e-40 gb|PHT64557.1| Chlorophyll a-b binding protein 3C, chloroplastic... 138 9e-40 ref|XP_009790937.1| PREDICTED: chlorophyll a-b binding protein 4... 139 1e-39 gb|AAL04435.1| chlorophyll a/b binding protein, partial [Beta vu... 138 1e-39 ref|WP_104052012.1| hypothetical protein [Arthrobacter sp. DWC3] 139 1e-39 gb|AFA36511.1| light harvesting chlorophyll a/b-binding protein ... 137 2e-39 emb|CAA52749.1| Chloropyll a/b binding protein, partial [Amarant... 138 2e-39 dbj|BAB41190.1| type I chlorophyll a/b-binding protein a, partia... 137 2e-39 emb|CAH59405.1| light harvesting protein 1, partial [Plantago ma... 139 2e-39 ref|XP_016448363.1| PREDICTED: chlorophyll a-b binding protein 4... 139 3e-39 ref|XP_016448716.1| PREDICTED: chlorophyll a-b binding protein 4... 139 3e-39 pdb|4LCZ|A Chain A, Crystal Structure Of A Multilayer-packed Maj... 139 4e-39 ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 2... 140 4e-39 gb|PSD55629.1| hypothetical protein C7G65_19000, partial [Acinet... 137 5e-39 pdb|1RWT|A Chain A, Crystal Structure Of Spinach Major Light-har... 139 5e-39 gb|PHU25901.1| Chlorophyll a-b binding protein 3C, chloroplastic... 137 5e-39 gb|PHT90202.1| Chlorophyll a-b binding protein 3C, chloroplastic... 137 5e-39 ref|WP_104169056.1| hypothetical protein [Arthrobacter sp. SX1312] 139 6e-39 ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 2... 139 6e-39 ref|XP_016490807.1| PREDICTED: chlorophyll a-b binding protein 2... 139 6e-39 >dbj|BAB41192.1| type I chlorophyll a/b-binding protein b, partial [Amaranthus tricolor] Length = 154 Score = 138 bits (348), Expect = 8e-40 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 56 FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 115 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 116 GGSFDPLGLAD 126 >gb|PHT64557.1| Chlorophyll a-b binding protein 3C, chloroplastic [Capsicum chinense] Length = 160 Score = 138 bits (348), Expect = 9e-40 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYRIAGG LGEV++PLYP Sbjct: 26 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP 85 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 86 GGSFDPLGLAD 96 >ref|XP_009790937.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, partial [Nicotiana sylvestris] Length = 185 Score = 139 bits (350), Expect = 1e-39 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR+AGG LGEV++PLYP Sbjct: 51 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP 110 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 111 GGSFDPLGLAE 121 >gb|AAL04435.1| chlorophyll a/b binding protein, partial [Beta vulgaris] Length = 168 Score = 138 bits (348), Expect = 1e-39 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR+AGG LGEV++PLYP Sbjct: 56 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP 115 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 116 GGSFDPLGLAD 126 >ref|WP_104052012.1| hypothetical protein [Arthrobacter sp. DWC3] Length = 208 Score = 139 bits (351), Expect = 1e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYRIAGG LGEV++PLYP Sbjct: 74 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP 133 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 134 GGSFDPLGLAE 144 >gb|AFA36511.1| light harvesting chlorophyll a/b-binding protein Lhcb1, partial [Lolium perenne] Length = 155 Score = 137 bits (346), Expect = 2e-39 Identities = 63/71 (88%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR+AGG LGE+++PLYP Sbjct: 21 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYP 80 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 81 GGSFDPLGLAD 91 >emb|CAA52749.1| Chloropyll a/b binding protein, partial [Amaranthus hypochondriacus] Length = 186 Score = 138 bits (348), Expect = 2e-39 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 52 FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 111 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 112 GGSFDPLGLAD 122 >dbj|BAB41190.1| type I chlorophyll a/b-binding protein a, partial [Amaranthus tricolor] Length = 154 Score = 137 bits (345), Expect = 2e-39 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNP+L+HAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 56 FKAGSQIFSEGGLDYLGNPTLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 115 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 116 GGSFDPLGLAD 126 >emb|CAH59405.1| light harvesting protein 1, partial [Plantago major] Length = 229 Score = 139 bits (351), Expect = 2e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR+AGG LGEV++PLYP Sbjct: 95 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP 154 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 155 GGSFDPLGLAE 165 >ref|XP_016448363.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, partial [Nicotiana tabacum] Length = 220 Score = 139 bits (350), Expect = 3e-39 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR+AGG LGEV++PLYP Sbjct: 133 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP 192 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 193 GGSFDPLGLAE 203 >ref|XP_016448716.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like, partial [Nicotiana tabacum] Length = 221 Score = 139 bits (350), Expect = 3e-39 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYR+AGG LGEV++PLYP Sbjct: 131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYP 190 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 191 GGSFDPLGLAE 201 >pdb|4LCZ|A Chain A, Crystal Structure Of A Multilayer-packed Major Light-harvesting Complex pdb|4LCZ|B Chain B, Crystal Structure Of A Multilayer-packed Major Light-harvesting Complex pdb|4LCZ|C Chain C, Crystal Structure Of A Multilayer-packed Major Light-harvesting Complex Length = 224 Score = 139 bits (349), Expect = 4e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 90 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 149 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 150 GGSFDPLGLAD 160 >ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Nicotiana tomentosiformis] Length = 265 Score = 140 bits (352), Expect = 4e-39 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 190 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 191 GGSFDPLGLAE 201 >gb|PSD55629.1| hypothetical protein C7G65_19000, partial [Acinetobacter baumannii] Length = 169 Score = 137 bits (344), Expect = 5e-39 Identities = 65/71 (91%), Positives = 68/71 (95%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSL+HAQSILAIWACQVILMGAVEGYRIAGG LGEV +PLYP Sbjct: 35 FKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYP 94 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 95 GGSFDPLGLAD 105 >pdb|1RWT|A Chain A, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|B Chain B, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|C Chain C, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|D Chain D, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|E Chain E, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|F Chain F, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|G Chain G, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|H Chain H, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|I Chain I, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution pdb|1RWT|J Chain J, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution Length = 232 Score = 139 bits (349), Expect = 5e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGG LGEV++PLYP Sbjct: 98 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYP 157 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 158 GGSFDPLGLAD 168 >gb|PHU25901.1| Chlorophyll a-b binding protein 3C, chloroplastic [Capsicum chinense] Length = 183 Score = 137 bits (345), Expect = 5e-39 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAG+QIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYRIAGG LGEV++PLYP Sbjct: 49 FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP 108 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 109 GGSFDPLGLAD 119 >gb|PHT90202.1| Chlorophyll a-b binding protein 3C, chloroplastic [Capsicum annuum] Length = 183 Score = 137 bits (345), Expect = 5e-39 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAG+QIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYRIAGG LGEV++PLYP Sbjct: 49 FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP 108 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL + Sbjct: 109 GGSFDPLGLAD 119 >ref|WP_104169056.1| hypothetical protein [Arthrobacter sp. SX1312] Length = 265 Score = 139 bits (351), Expect = 6e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQV+LMGAVEGYRIAGG LGEV++PLYP Sbjct: 131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYP 190 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 191 GGSFDPLGLAE 201 >ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Nicotiana sylvestris] ref|XP_016487828.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Nicotiana tabacum] ref|XP_019260205.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic [Nicotiana attenuata] dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] gb|OIT39344.1| chlorophyll a-b binding protein 21, chloroplastic [Nicotiana attenuata] Length = 265 Score = 139 bits (351), Expect = 6e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR+AGG LGEV++PLYP Sbjct: 131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP 190 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 191 GGSFDPLGLAE 201 >ref|XP_016490807.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Nicotiana tabacum] Length = 265 Score = 139 bits (351), Expect = 6e-39 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = -3 Query: 308 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGLLGEVINPLYP 129 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYR+AGG LGEV++PLYP Sbjct: 131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYP 190 Query: 128 GGSFDPLGLGE 96 GGSFDPLGL E Sbjct: 191 GGSFDPLGLAE 201