BLASTX nr result
ID: Astragalus22_contig00020398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020398 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020213782.1| protein HASTY 1 [Cajanus cajan] >gi|10123605... 60 1e-07 ref|XP_007147117.1| hypothetical protein PHAVU_006G0974001g, par... 58 5e-07 ref|XP_022642780.1| protein HASTY 1 isoform X2 [Vigna radiata va... 56 2e-06 gb|PNY05529.1| protein HASTY 1-like [Trifolium pratense] 56 2e-06 ref|XP_017436145.1| PREDICTED: protein HASTY 1 [Vigna angularis]... 56 2e-06 ref|XP_014518619.1| protein HASTY 1 isoform X1 [Vigna radiata va... 56 2e-06 gb|KOM52918.1| hypothetical protein LR48_Vigan09g157700 [Vigna a... 56 2e-06 ref|XP_020981912.1| protein HASTY 1 [Arachis duranensis] 56 2e-06 ref|XP_020959727.1| protein HASTY 1 [Arachis ipaensis] 56 2e-06 ref|XP_004494659.1| PREDICTED: protein HASTY 1 [Cicer arietinum] 55 3e-06 dbj|GAU11580.1| hypothetical protein TSUD_345710 [Trifolium subt... 55 5e-06 ref|XP_003626364.1| HASTY-like protein [Medicago truncatula] >gi... 54 7e-06 >ref|XP_020213782.1| protein HASTY 1 [Cajanus cajan] gb|KYP71761.1| Exportin-5 [Cajanus cajan] Length = 1210 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS RPRSSANAPESKVDDG VG Sbjct: 1173 AQKSVNIITNVSTRPRSSANAPESKVDDGDVVG 1205 >ref|XP_007147117.1| hypothetical protein PHAVU_006G0974001g, partial [Phaseolus vulgaris] gb|ESW19111.1| hypothetical protein PHAVU_006G0974001g, partial [Phaseolus vulgaris] Length = 1167 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+R RSSANAPESKVDDG VG Sbjct: 1130 AQKSVNIITNVSMRQRSSANAPESKVDDGDVVG 1162 >ref|XP_022642780.1| protein HASTY 1 isoform X2 [Vigna radiata var. radiata] Length = 1073 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+R RSS NAPESKVDDG VG Sbjct: 1036 AQKSVNIITNVSMRQRSSVNAPESKVDDGDVVG 1068 >gb|PNY05529.1| protein HASTY 1-like [Trifolium pratense] Length = 1118 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+RPRSSANAPES V DG VG Sbjct: 1081 AQKSVNIITNVSMRPRSSANAPESNVHDGDVVG 1113 >ref|XP_017436145.1| PREDICTED: protein HASTY 1 [Vigna angularis] dbj|BAT88011.1| hypothetical protein VIGAN_05144100 [Vigna angularis var. angularis] Length = 1208 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+R RSS NAPESKVDDG VG Sbjct: 1171 AQKSVNIITNVSMRQRSSVNAPESKVDDGDVVG 1203 >ref|XP_014518619.1| protein HASTY 1 isoform X1 [Vigna radiata var. radiata] Length = 1208 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+R RSS NAPESKVDDG VG Sbjct: 1171 AQKSVNIITNVSMRQRSSVNAPESKVDDGDVVG 1203 >gb|KOM52918.1| hypothetical protein LR48_Vigan09g157700 [Vigna angularis] Length = 1231 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+R RSS NAPESKVDDG VG Sbjct: 1194 AQKSVNIITNVSMRQRSSVNAPESKVDDGDVVG 1226 >ref|XP_020981912.1| protein HASTY 1 [Arachis duranensis] Length = 1127 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS RPRSS NA ES+VDDG P+G Sbjct: 1090 AQKSVNIITNVSTRPRSSGNASESRVDDGEPLG 1122 >ref|XP_020959727.1| protein HASTY 1 [Arachis ipaensis] Length = 1195 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS RPRSS NA ES+VDDG P+G Sbjct: 1158 AQKSVNIITNVSTRPRSSGNASESRVDDGEPLG 1190 >ref|XP_004494659.1| PREDICTED: protein HASTY 1 [Cicer arietinum] Length = 1203 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+RPRSSANAPES V DG +G Sbjct: 1166 AQKSVNIITNVSMRPRSSANAPESNVHDGEVIG 1198 >dbj|GAU11580.1| hypothetical protein TSUD_345710 [Trifolium subterraneum] Length = 1243 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+RPRSS NAPES V DG +G Sbjct: 1206 AQKSVNIITNVSMRPRSSVNAPESNVHDGDAIG 1238 >ref|XP_003626364.1| HASTY-like protein [Medicago truncatula] gb|AES82582.1| HASTY-like protein [Medicago truncatula] Length = 1191 Score = 54.3 bits (129), Expect = 7e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 386 AQKSVNIITNVSLRPRSSANAPESKVDDGGPVG 288 AQKSVNIITNVS+RPRSSA+APES V DG VG Sbjct: 1154 AQKSVNIITNVSMRPRSSASAPESNVHDGDVVG 1186