BLASTX nr result
ID: Astragalus22_contig00020392
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020392 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021674355.1| secretory carrier-associated membrane protei... 71 2e-12 ref|XP_021674354.1| secretory carrier-associated membrane protei... 71 2e-12 ref|XP_021674353.1| secretory carrier-associated membrane protei... 71 2e-12 ref|XP_021599292.1| secretory carrier-associated membrane protei... 71 3e-12 gb|PNT54311.1| hypothetical protein POPTR_001G134100v3 [Populus ... 71 3e-12 ref|XP_021653706.1| secretory carrier-associated membrane protei... 71 3e-12 ref|XP_006368326.1| secretory carrier membrane family protein [P... 71 3e-12 ref|XP_019445255.1| PREDICTED: secretory carrier-associated memb... 71 3e-12 ref|XP_011018450.1| PREDICTED: secretory carrier-associated memb... 71 3e-12 ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Popu... 71 3e-12 gb|ACU18292.1| unknown [Glycine max] 67 3e-12 ref|XP_021674349.1| secretory carrier-associated membrane protei... 71 3e-12 ref|XP_012069332.1| secretory carrier-associated membrane protei... 71 4e-12 ref|XP_002519001.1| PREDICTED: secretory carrier-associated memb... 71 4e-12 ref|XP_021594385.1| secretory carrier-associated membrane protei... 70 7e-12 ref|XP_021765538.1| secretory carrier-associated membrane protei... 70 8e-12 ref|XP_019421871.1| PREDICTED: secretory carrier-associated memb... 69 8e-12 ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phas... 70 9e-12 ref|XP_020248753.1| secretory carrier-associated membrane protei... 70 9e-12 ref|XP_009409813.1| PREDICTED: secretory carrier-associated memb... 70 9e-12 >ref|XP_021674355.1| secretory carrier-associated membrane protein 4-like isoform X4 [Hevea brasiliensis] Length = 231 Score = 71.2 bits (173), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 197 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 228 >ref|XP_021674354.1| secretory carrier-associated membrane protein 4-like isoform X3 [Hevea brasiliensis] Length = 251 Score = 71.2 bits (173), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 217 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 248 >ref|XP_021674353.1| secretory carrier-associated membrane protein 4-like isoform X2 [Hevea brasiliensis] Length = 262 Score = 71.2 bits (173), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 228 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 259 >ref|XP_021599292.1| secretory carrier-associated membrane protein 4 [Manihot esculenta] gb|OAY24379.1| hypothetical protein MANES_17G010900 [Manihot esculenta] Length = 268 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 237 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 268 >gb|PNT54311.1| hypothetical protein POPTR_001G134100v3 [Populus trichocarpa] Length = 269 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_021653706.1| secretory carrier-associated membrane protein 4 [Hevea brasiliensis] Length = 269 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_006368326.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 269 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_019445255.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Lupinus angustifolius] Length = 270 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 239 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270 >ref|XP_011018450.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Populus euphratica] Length = 270 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 239 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270 >ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] gb|ABK93338.1| unknown [Populus trichocarpa] Length = 270 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 239 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270 >gb|ACU18292.1| unknown [Glycine max] Length = 88 Score = 67.4 bits (163), Expect = 3e-12 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYL+GFG+FCLE+LLS WVLQKIYMYFRGHK Sbjct: 57 IFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 88 >ref|XP_021674349.1| secretory carrier-associated membrane protein 4-like isoform X1 [Hevea brasiliensis] ref|XP_021674350.1| secretory carrier-associated membrane protein 4-like isoform X1 [Hevea brasiliensis] ref|XP_021674351.1| secretory carrier-associated membrane protein 4-like isoform X1 [Hevea brasiliensis] ref|XP_021674352.1| secretory carrier-associated membrane protein 4-like isoform X1 [Hevea brasiliensis] Length = 272 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_012069332.1| secretory carrier-associated membrane protein 4 [Jatropha curcas] gb|KDP40432.1| hypothetical protein JCGZ_03847 [Jatropha curcas] Length = 269 Score = 70.9 bits (172), Expect = 4e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQK+YMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKVYMYFRGHK 269 >ref|XP_002519001.1| PREDICTED: secretory carrier-associated membrane protein 4 [Ricinus communis] ref|XP_015574490.1| PREDICTED: secretory carrier-associated membrane protein 4 [Ricinus communis] gb|EEF43534.1| secretory carrier membrane protein, putative [Ricinus communis] Length = 272 Score = 70.9 bits (172), Expect = 4e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQK+YMYFRGHK Sbjct: 238 IFYLVGFGLFCLESLLSLWVLQKVYMYFRGHK 269 >ref|XP_021594385.1| secretory carrier-associated membrane protein 4-like isoform X1 [Manihot esculenta] gb|OAY29954.1| hypothetical protein MANES_15G184900 [Manihot esculenta] Length = 269 Score = 70.1 bits (170), Expect = 7e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYL+GFGLFCLESLLSLWVLQKIYMYFRGHK Sbjct: 238 IFYLLGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_021765538.1| secretory carrier-associated membrane protein 4-like [Chenopodium quinoa] Length = 256 Score = 69.7 bits (169), Expect = 8e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 +FYLVGFGLFCLE+LLSLWVLQKIYMYFRGHK Sbjct: 225 VFYLVGFGLFCLEALLSLWVLQKIYMYFRGHK 256 >ref|XP_019421871.1| PREDICTED: secretory carrier-associated membrane protein 4-like isoform X2 [Lupinus angustifolius] Length = 231 Score = 69.3 bits (168), Expect = 8e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLESLLSLWVLQK YMYFRGHK Sbjct: 200 IFYLVGFGLFCLESLLSLWVLQKTYMYFRGHK 231 >ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] Length = 262 Score = 69.7 bits (169), Expect = 9e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYL+GFGLFCLE+LLSLWVLQKIYMYFRGHK Sbjct: 231 IFYLIGFGLFCLEALLSLWVLQKIYMYFRGHK 262 >ref|XP_020248753.1| secretory carrier-associated membrane protein 4-like [Asparagus officinalis] Length = 266 Score = 69.7 bits (169), Expect = 9e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYLVGFGLFCLE+LLSLWVLQK+YMYFRGHK Sbjct: 235 IFYLVGFGLFCLETLLSLWVLQKVYMYFRGHK 266 >ref|XP_009409813.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Musa acuminata subsp. malaccensis] Length = 268 Score = 69.7 bits (169), Expect = 9e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 359 IFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 264 IFYL+GFGLFCLE+LLSLWVLQKIYMYFRGHK Sbjct: 237 IFYLIGFGLFCLETLLSLWVLQKIYMYFRGHK 268