BLASTX nr result
ID: Astragalus22_contig00020141
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020141 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607535.1| peroxisomal acyl-CoA oxidase [Medicago trunc... 66 3e-10 dbj|GAU46772.1| hypothetical protein TSUD_92670 [Trifolium subte... 65 4e-10 ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 64 1e-09 gb|PNX86880.1| peroxisomal acyl-CoA oxidase [Trifolium pratense] 61 2e-09 gb|KOM27431.1| hypothetical protein LR48_Vigan406s024100 [Vigna ... 52 3e-06 gb|KOM56230.1| hypothetical protein LR48_Vigan10g212200 [Vigna a... 52 3e-06 ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 53 8e-06 >ref|XP_003607535.1| peroxisomal acyl-CoA oxidase [Medicago truncatula] gb|AES89732.1| peroxisomal acyl-CoA oxidase [Medicago truncatula] Length = 678 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +3 Query: 177 MDPHSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELSETN 311 MD H ++RRT IL+NHLRHDPP A IL CL++SPPELSE+N Sbjct: 1 MDNHRITRRTTILTNHLRHDPPTAPTILHNHACLSHSPPELSESN 45 >dbj|GAU46772.1| hypothetical protein TSUD_92670 [Trifolium subterraneum] Length = 678 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +3 Query: 177 MDPHSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELSETN 311 MD + +SRRT IL+NHLRHDPP ++ IL + CL YSPPELSE+N Sbjct: 1 MDTNRISRRTKILTNHLRHDPPTSTTILQHNACLCYSPPELSESN 45 >ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cicer arietinum] Length = 678 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +3 Query: 177 MDPHSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELSETN 311 MD +SRRT ILSNHLR DPP A++IL ++ CL+YSPPELSE+N Sbjct: 1 MDTDRISRRTEILSNHLRLDPPTATSILQQNGCLSYSPPELSESN 45 >gb|PNX86880.1| peroxisomal acyl-CoA oxidase [Trifolium pratense] Length = 158 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +3 Query: 177 MDPHSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELSETN 311 MD + + RRT IL+NHLRHD P A+ IL + CL YSPPELSE+N Sbjct: 1 MDTNRIYRRTEILTNHLRHDQPTATTILQHNACLCYSPPELSESN 45 >gb|KOM27431.1| hypothetical protein LR48_Vigan406s024100 [Vigna angularis] Length = 93 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 186 HSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELS 302 H VSRRT IL+NHL PP S++L CL+YSPPELS Sbjct: 3 HRVSRRTEILTNHLLRRAPPPSSVLQPHRCLSYSPPELS 41 >gb|KOM56230.1| hypothetical protein LR48_Vigan10g212200 [Vigna angularis] Length = 102 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 186 HSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELS 302 H VSRRT IL+NHL PP S++L CL+YSPPELS Sbjct: 3 HRVSRRTEILTNHLLRRAPPPSSVLQPHRCLSYSPPELS 41 >ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Glycine max] gb|KRH55840.1| hypothetical protein GLYMA_06G285400 [Glycine max] Length = 675 Score = 53.1 bits (126), Expect = 8e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +3 Query: 177 MDPHSVSRRTWILSNHLRHDPPPASAILDRSMCLNYSPPELSET 308 MD VSRRT +L+NHL PP SA+L CL+YSPPELS T Sbjct: 1 MDNDRVSRRTEVLTNHLLRRTPPPSALLHPHPCLSYSPPELSNT 44