BLASTX nr result
ID: Astragalus22_contig00020038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00020038 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 ref|XP_013467967.1| organelle transcript processing protein, put... 55 4e-06 gb|KYP73902.1| Putative pentatricopeptide repeat-containing prot... 54 9e-06 ref|XP_020210320.1| pentatricopeptide repeat-containing protein ... 54 9e-06 >ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 573 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 247 IHDVVLKYGLILDHFVCASLVDTYAKSMVI 336 IHDVVLK+GL+LDHFVCA+LVD YAK MVI Sbjct: 123 IHDVVLKHGLLLDHFVCATLVDMYAKCMVI 152 >ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cicer arietinum] Length = 573 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 247 IHDVVLKYGLILDHFVCASLVDTYAKSMVI 336 IHDVVLK+GL+LDHFVCA+LVD YAK MVI Sbjct: 123 IHDVVLKHGLLLDHFVCATLVDMYAKCMVI 152 >ref|XP_013467967.1| organelle transcript processing protein, putative [Medicago truncatula] gb|KEH42004.1| organelle transcript processing protein, putative [Medicago truncatula] Length = 574 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 247 IHDVVLKYGLILDHFVCASLVDTYAKSMVI 336 IHDVVLKYGL+LDHFVCA+LVD YAK VI Sbjct: 123 IHDVVLKYGLVLDHFVCATLVDMYAKCAVI 152 >gb|KYP73902.1| Putative pentatricopeptide repeat-containing protein At3g23330 family [Cajanus cajan] Length = 511 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 247 IHDVVLKYGLILDHFVCASLVDTYAKSMVI 336 IHDVVLK+GL LDHFVCASLVD YAK MV+ Sbjct: 61 IHDVVLKHGLHLDHFVCASLVDMYAKCMVV 90 >ref|XP_020210320.1| pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Cajanus cajan] Length = 573 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 247 IHDVVLKYGLILDHFVCASLVDTYAKSMVI 336 IHDVVLK+GL LDHFVCASLVD YAK MV+ Sbjct: 123 IHDVVLKHGLHLDHFVCASLVDMYAKCMVV 152