BLASTX nr result
ID: Astragalus22_contig00019364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019364 (1457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503287.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-18 ref|XP_012572042.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-16 gb|KRH41815.1| hypothetical protein GLYMA_08G053100 [Glycine max... 91 7e-16 gb|KRH41813.1| hypothetical protein GLYMA_08G053100 [Glycine max... 91 8e-16 ref|XP_013447397.1| pentatricopeptide (PPR) repeat protein [Medi... 90 3e-15 ref|XP_020215476.1| putative pentatricopeptide repeat-containing... 87 1e-14 ref|XP_019446141.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-14 gb|KHN00162.1| Putative pentatricopeptide repeat-containing prot... 83 3e-13 gb|KRH41819.1| hypothetical protein GLYMA_08G053100 [Glycine max... 83 3e-13 ref|XP_006584901.1| PREDICTED: putative pentatricopeptide repeat... 83 3e-13 gb|KYP67459.1| hypothetical protein KK1_023800 [Cajanus cajan] 82 1e-12 gb|PNY04046.1| pentatricopeptide repeat-containing protein mitoc... 80 3e-12 ref|XP_003631093.2| pentatricopeptide (PPR) repeat protein [Medi... 79 7e-12 gb|OIW10124.1| hypothetical protein TanjilG_21961 [Lupinus angus... 77 4e-11 gb|KYP38467.1| hypothetical protein KK1_040282 [Cajanus cajan] 65 2e-07 ref|XP_016163962.1| pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_020958418.1| putative pentatricopeptide repeat-containing... 64 4e-07 ref|XP_020958441.1| pentatricopeptide repeat-containing protein ... 61 4e-07 ref|XP_014617198.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-07 gb|KRH39063.1| hypothetical protein GLYMA_09G175700, partial [Gl... 63 7e-07 >ref|XP_004503287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X1 [Cicer arietinum] Length = 565 Score = 99.4 bits (246), Expect = 2e-18 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQ 1297 KMDDNDCPPDAVTFETIIGALLEKNE+DK EELR EM+ RGLVNIEKRLMH Q Sbjct: 512 KMDDNDCPPDAVTFETIIGALLEKNESDKAEELRQEMLTRGLVNIEKRLMHGQ 564 >ref|XP_012572042.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like isoform X2 [Cicer arietinum] Length = 565 Score = 91.7 bits (226), Expect = 6e-16 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKR 1312 KMDDNDCPPDAVTFETIIGALLEKNE+DK EELR EM+ RGLVNIEKR Sbjct: 512 KMDDNDCPPDAVTFETIIGALLEKNESDKAEELRQEMLTRGLVNIEKR 559 >gb|KRH41815.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41816.1| hypothetical protein GLYMA_08G053100 [Glycine max] Length = 518 Score = 91.3 bits (225), Expect = 7e-16 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQ 1297 KMDDNDCPPDAVTFETIIGAL E+NETDK E+LR EMI RGLVN E RL+HEQ Sbjct: 466 KMDDNDCPPDAVTFETIIGALQERNETDKAEKLRLEMIERGLVNDEARLVHEQ 518 >gb|KRH41813.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41814.1| hypothetical protein GLYMA_08G053100 [Glycine max] Length = 551 Score = 91.3 bits (225), Expect = 8e-16 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQ 1297 KMDDNDCPPDAVTFETIIGAL E+NETDK E+LR EMI RGLVN E RL+HEQ Sbjct: 499 KMDDNDCPPDAVTFETIIGALQERNETDKAEKLRLEMIERGLVNDEARLVHEQ 551 >ref|XP_013447397.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|ABE80159.2| Tetratricopeptide-like helical [Medicago truncatula] gb|KEH21424.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 695 Score = 89.7 bits (221), Expect = 3e-15 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQQG 1291 KM+DND PPDA+TFE IIG LL++NETDK E+LR EMIARGLVNIEKRLM+E+ G Sbjct: 639 KMEDNDRPPDAITFEIIIGVLLQRNETDKAEKLREEMIARGLVNIEKRLMYEEGG 693 >ref|XP_020215476.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Cajanus cajan] Length = 557 Score = 87.4 bits (215), Expect = 1e-14 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQQ 1294 KMD NDCPPDAVTFETIIG L E+NETDK E+LR EMI RGLVN EKRLM +Q+ Sbjct: 501 KMDGNDCPPDAVTFETIIGGLQERNETDKAEKLRQEMIERGLVNDEKRLMPQQR 554 >ref|XP_019446141.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Lupinus angustifolius] ref|XP_019446142.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Lupinus angustifolius] Length = 567 Score = 87.0 bits (214), Expect = 2e-14 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLMHEQQG 1291 KMD N CPPDAVTFETIIGALLE+NETDK E+L EMIARGLV E R + EQQG Sbjct: 511 KMDGNGCPPDAVTFETIIGALLERNETDKAEKLHQEMIARGLVKNETRFLREQQG 565 >gb|KHN00162.1| Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 510 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLM 1306 KMDDNDCPPDAVTFETIIGAL E+NETDK E+LR EMI RGLVN E R++ Sbjct: 454 KMDDNDCPPDAVTFETIIGALQERNETDKAEKLRLEMIERGLVNDEARVV 503 >gb|KRH41819.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41820.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41821.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41822.1| hypothetical protein GLYMA_08G053100 [Glycine max] Length = 522 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLM 1306 KMDDNDCPPDAVTFETIIGAL E+NETDK E+LR EMI RGLVN E R++ Sbjct: 466 KMDDNDCPPDAVTFETIIGALQERNETDKAEKLRLEMIERGLVNDEARVV 515 >ref|XP_006584901.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] gb|KRH41817.1| hypothetical protein GLYMA_08G053100 [Glycine max] gb|KRH41818.1| hypothetical protein GLYMA_08G053100 [Glycine max] Length = 555 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKRLM 1306 KMDDNDCPPDAVTFETIIGAL E+NETDK E+LR EMI RGLVN E R++ Sbjct: 499 KMDDNDCPPDAVTFETIIGALQERNETDKAEKLRLEMIERGLVNDEARVV 548 >gb|KYP67459.1| hypothetical protein KK1_023800 [Cajanus cajan] Length = 548 Score = 81.6 bits (200), Expect = 1e-12 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEKR 1312 KMD NDCPPDAVTFETIIG L E+NETDK E+LR EMI RGLVN EKR Sbjct: 501 KMDGNDCPPDAVTFETIIGGLQERNETDKAEKLRQEMIERGLVNDEKR 548 >gb|PNY04046.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] gb|PNY07523.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 607 Score = 80.1 bits (196), Expect = 3e-12 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEK 1315 KMDDNDCPPDAVTFETIIGALLEKNETDK E+L EMIARG + EK Sbjct: 500 KMDDNDCPPDAVTFETIIGALLEKNETDKAEKLCQEMIARGSLYSEK 546 >ref|XP_003631093.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AET05569.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 704 Score = 79.3 bits (194), Expect = 7e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIEK 1315 KM+DND PPDA+TFE IIG LL++NETDK E+LR EMIARGLVNIEK Sbjct: 639 KMEDNDRPPDAITFEIIIGVLLQRNETDKAEKLREEMIARGLVNIEK 685 >gb|OIW10124.1| hypothetical protein TanjilG_21961 [Lupinus angustifolius] Length = 570 Score = 76.6 bits (187), Expect = 4e-11 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVNIE 1318 KMD N CPPDAVTFETIIGALLE+NETDK E+L EMIARGLV E Sbjct: 433 KMDGNGCPPDAVTFETIIGALLERNETDKAEKLHQEMIARGLVKNE 478 >gb|KYP38467.1| hypothetical protein KK1_040282 [Cajanus cajan] Length = 505 Score = 64.7 bits (156), Expect = 2e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLV 1327 KM+DN C PDA TF+ +I ALLEKNE DK E+L HEM+ARGL+ Sbjct: 459 KMEDNGCLPDAATFDLVIHALLEKNENDKAEKLLHEMVARGLL 501 >ref|XP_016163962.1| pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 127 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLV 1327 KM+DN C PDAVT+E IIGAL EK E D E+L EMI+RGL+ Sbjct: 83 KMEDNGCLPDAVTYEIIIGALFEKGENDNAEKLLREMISRGLL 125 >ref|XP_020958418.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 553 Score = 63.9 bits (154), Expect = 4e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVN 1324 KM+ N C PDAVTFETIIGAL EK+E D E+L EM+ARGL+N Sbjct: 510 KMEGNGCLPDAVTFETIIGALFEKDENDMAEKLLREMVARGLLN 553 >ref|XP_020958441.1| pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 204 Score = 61.2 bits (147), Expect = 4e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLVN 1324 KM+ N C PDAVTFETII AL EK+E D E+L EMIARGL+N Sbjct: 160 KMEGNGCLPDAVTFETIIRALFEKDENDMAEKLLREMIARGLLN 203 >ref|XP_014617198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Glycine max] gb|KRH39056.1| hypothetical protein GLYMA_09G175000 [Glycine max] Length = 311 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLV 1327 KM+DN C +AVTFE II AL EK+E DKVE+L HEMIARGL+ Sbjct: 269 KMEDNGCKANAVTFEIIISALFEKDENDKVEKLLHEMIARGLL 311 >gb|KRH39063.1| hypothetical protein GLYMA_09G175700, partial [Glycine max] Length = 494 Score = 63.2 bits (152), Expect = 7e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 1455 KMDDNDCPPDAVTFETIIGALLEKNETDKVEELRHEMIARGLV 1327 KM+DN C P AVTFE II AL EK+E DK E+L HEMIARGL+ Sbjct: 452 KMEDNGCIPSAVTFEIIINALFEKDENDKAEKLLHEMIARGLL 494