BLASTX nr result
ID: Astragalus22_contig00019357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019357 (244 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608310.2| hypothetical protein MTR_4g092510 [Medicago ... 53 4e-06 >ref|XP_003608310.2| hypothetical protein MTR_4g092510 [Medicago truncatula] gb|AES90507.2| hypothetical protein MTR_4g092510 [Medicago truncatula] Length = 557 Score = 53.1 bits (126), Expect = 4e-06 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 2 PDILKLKLPFLCNLKSLQLNMCWDLYR--FSASSWRDIKMELAGGKSWKEIVELQEAIKK 175 PD+L++KLP LCNLKSL++ + ++R F S ++ A KS KE+ +L++A K Sbjct: 365 PDLLEVKLPSLCNLKSLEVELVPFIHRDGFLFRSIEAAMLKKAAAKSRKEVAKLRKAFKA 424 Query: 176 WSNPRYSSIMDGMIDCL 226 PR +I DGM+D L Sbjct: 425 RLEPR--AIPDGMVDFL 439