BLASTX nr result
ID: Astragalus22_contig00019338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019338 (779 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013457610.1| DWNN domain, A CCHC-type zinc finger protein... 75 1e-16 >ref|XP_013457610.1| DWNN domain, A CCHC-type zinc finger protein [Medicago truncatula] gb|KEH31641.1| DWNN domain, A CCHC-type zinc finger protein [Medicago truncatula] Length = 748 Score = 75.5 bits (184), Expect(2) = 1e-16 Identities = 43/72 (59%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = -2 Query: 778 SSIKSKTVCAFRCLNFPLYPRGLLCSIYFLWSVDQKFGQKPEACERTLIALDN-STYSFF 602 SSIKSKTVC F CLNF GLLC+ FLW KF Q P AC RTLIALDN S Y Sbjct: 641 SSIKSKTVCTFYCLNFHPSLFGLLCACDFLWFFYLKFAQNPPACRRTLIALDNTSNYFCS 700 Query: 601 FNYCSL-GNCFI 569 FNY ++ GN F+ Sbjct: 701 FNYIAVFGNYFM 712 Score = 39.7 bits (91), Expect(2) = 1e-16 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -1 Query: 575 FYWRHLSIKRFVYQVMLSG*S*NG*GSVDPLVLPLFYGHQRQMV 444 F W H IKRFVYQ +L P VLPLFYG Q+QMV Sbjct: 711 FMWLHSLIKRFVYQAIL------WLREGCPFVLPLFYGPQQQMV 748