BLASTX nr result
ID: Astragalus22_contig00019333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019333 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021803598.1| glyoxylate/succinic semialdehyde reductase 2... 76 2e-15 gb|KDO65262.1| hypothetical protein CISIN_1g0182132mg, partial [... 74 4e-15 ref|XP_015935468.1| glyoxylate/succinic semialdehyde reductase 2... 80 4e-15 ref|XP_020964150.1| glyoxylate/succinic semialdehyde reductase 2... 80 4e-15 gb|AFK47552.1| unknown [Lotus japonicus] 76 5e-15 dbj|GAY38563.1| hypothetical protein CUMW_037610 [Citrus unshiu]... 74 6e-15 gb|KOM44400.1| hypothetical protein LR48_Vigan05g200500 [Vigna a... 79 8e-15 gb|ACJ85337.1| unknown [Medicago truncatula] 74 8e-15 ref|XP_022152653.1| glyoxylate/succinic semialdehyde reductase 2... 79 9e-15 ref|XP_022152652.1| glyoxylate/succinic semialdehyde reductase 2... 79 1e-14 gb|KYP58389.1| Putative oxidoreductase GLYR1 [Cajanus cajan] 78 1e-14 gb|PKI58334.1| hypothetical protein CRG98_021272 [Punica granatum] 75 1e-14 ref|XP_017424113.1| PREDICTED: glyoxylate/succinic semialdehyde ... 79 1e-14 ref|XP_014501292.1| glyoxylate/succinic semialdehyde reductase 2... 79 1e-14 gb|OIT19463.1| glyoxylatesuccinic semialdehyde reductase 2, chlo... 72 2e-14 gb|PON48167.1| Fatty oxidation complex subunit, partial [Paraspo... 79 2e-14 ref|XP_020223670.1| glyoxylate/succinic semialdehyde reductase 2... 78 2e-14 gb|PNT43554.1| hypothetical protein POPTR_003G040500v3, partial ... 72 2e-14 ref|XP_023525258.1| glyoxylate/succinic semialdehyde reductase 2... 78 3e-14 ref|XP_022998569.1| glyoxylate/succinic semialdehyde reductase 2... 78 3e-14 >ref|XP_021803598.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like [Prunus avium] Length = 91 Score = 75.9 bits (185), Expect = 2e-15 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SD+DFSAVIEALK K Q+ Sbjct: 49 ESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKPKLQQ 91 >gb|KDO65262.1| hypothetical protein CISIN_1g0182132mg, partial [Citrus sinensis] gb|KDO65263.1| hypothetical protein CISIN_1g0182132mg, partial [Citrus sinensis] gb|KDO65264.1| hypothetical protein CISIN_1g0182132mg, partial [Citrus sinensis] Length = 50 Score = 73.9 bits (180), Expect = 4e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSK 120 ESVSQSTPIAAAANELYKVAKSHG SD+DFSAVIEALK+K Sbjct: 10 ESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAK 49 >ref|XP_015935468.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic [Arachis duranensis] Length = 350 Score = 80.1 bits (196), Expect = 4e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SD+DFSAVIEALKSKFQ+ Sbjct: 307 ESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKSKFQQ 349 >ref|XP_020964150.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic [Arachis ipaensis] Length = 351 Score = 80.1 bits (196), Expect = 4e-15 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SD+DFSAVIEALKSKFQ+ Sbjct: 308 ESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKSKFQQ 350 >gb|AFK47552.1| unknown [Lotus japonicus] Length = 142 Score = 76.3 bits (186), Expect = 5e-15 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ PIAAAANELYKVAKSHG SDQDFSAVIEALKSKFQ Sbjct: 96 ESVSQPIPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKFQ 137 >dbj|GAY38563.1| hypothetical protein CUMW_037610 [Citrus unshiu] dbj|GAY38564.1| hypothetical protein CUMW_037610 [Citrus unshiu] Length = 67 Score = 73.9 bits (180), Expect = 6e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSK 120 ESVSQSTPIAAAANELYKVAKSHG SD+DFSAVIEALK+K Sbjct: 27 ESVSQSTPIAAAANELYKVAKSHGLSDEDFSAVIEALKAK 66 >gb|KOM44400.1| hypothetical protein LR48_Vigan05g200500 [Vigna angularis] Length = 284 Score = 78.6 bits (192), Expect = 8e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ TPIAAAANELYKVAKSHG SDQDFSAVIEALKSKFQ Sbjct: 238 ESVSQPTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKFQ 279 >gb|ACJ85337.1| unknown [Medicago truncatula] Length = 81 Score = 73.9 bits (180), Expect = 8e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 E VSQ PIAAAANELYKVAKSHG+SD+DFSAVIEALKSKFQ Sbjct: 35 EFVSQPIPIAAAANELYKVAKSHGYSDEDFSAVIEALKSKFQ 76 >ref|XP_022152653.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like isoform X2 [Momordica charantia] Length = 331 Score = 79.0 bits (193), Expect = 9e-15 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALKSK Q+ Sbjct: 289 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKLQQ 331 >ref|XP_022152652.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like isoform X1 [Momordica charantia] Length = 356 Score = 79.0 bits (193), Expect = 1e-14 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALKSK Q+ Sbjct: 314 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKLQQ 356 >gb|KYP58389.1| Putative oxidoreductase GLYR1 [Cajanus cajan] Length = 284 Score = 78.2 bits (191), Expect = 1e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALKSK Q Sbjct: 238 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKIQ 279 >gb|PKI58334.1| hypothetical protein CRG98_021272 [Punica granatum] Length = 120 Score = 74.7 bits (182), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSK 120 ESVSQSTP+AAAANELYKVAKSHG SD+DFSAVIEALKSK Sbjct: 80 ESVSQSTPVAAAANELYKVAKSHGLSDEDFSAVIEALKSK 119 >ref|XP_017424113.1| PREDICTED: glyoxylate/succinic semialdehyde reductase 2, chloroplastic [Vigna angularis] dbj|BAT91717.1| hypothetical protein VIGAN_07033500 [Vigna angularis var. angularis] Length = 326 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ TPIAAAANELYKVAKSHG SDQDFSAVIEALKSKFQ Sbjct: 280 ESVSQPTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKFQ 321 >ref|XP_014501292.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic [Vigna radiata var. radiata] Length = 326 Score = 78.6 bits (192), Expect = 1e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ TPIAAAANELYKVAKSHG SDQDFSAVIEALKSKFQ Sbjct: 280 ESVSQPTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKFQ 321 >gb|OIT19463.1| glyoxylatesuccinic semialdehyde reductase 2, chloroplastic, partial [Nicotiana attenuata] Length = 49 Score = 72.4 bits (176), Expect = 2e-14 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ TPIAAA NELYKVAKSHG SDQDFSAVIEALK K Q Sbjct: 5 ESVSQPTPIAAATNELYKVAKSHGLSDQDFSAVIEALKVKLQ 46 >gb|PON48167.1| Fatty oxidation complex subunit, partial [Parasponia andersonii] Length = 377 Score = 78.6 bits (192), Expect = 2e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAV+EALK K Q+ Sbjct: 335 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVMEALKGKLQQ 377 >ref|XP_020223670.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic [Cajanus cajan] Length = 334 Score = 78.2 bits (191), Expect = 2e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALKSK Q Sbjct: 288 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKSKIQ 329 >gb|PNT43554.1| hypothetical protein POPTR_003G040500v3, partial [Populus trichocarpa] Length = 64 Score = 72.4 bits (176), Expect = 2e-14 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQ 126 ESVSQ TPIAAAANELYKVAKSHG SD DFSAVIEALK K Q Sbjct: 22 ESVSQPTPIAAAANELYKVAKSHGLSDSDFSAVIEALKGKVQ 63 >ref|XP_023525258.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 356 Score = 77.8 bits (190), Expect = 3e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALK+K Q+ Sbjct: 314 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKAKLQQ 356 >ref|XP_022998569.1| glyoxylate/succinic semialdehyde reductase 2, chloroplastic-like [Cucurbita maxima] Length = 356 Score = 77.8 bits (190), Expect = 3e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 1 ESVSQSTPIAAAANELYKVAKSHGFSDQDFSAVIEALKSKFQE 129 ESVSQSTPIAAAANELYKVAKSHG SDQDFSAVIEALK+K Q+ Sbjct: 314 ESVSQSTPIAAAANELYKVAKSHGLSDQDFSAVIEALKAKLQQ 356