BLASTX nr result
ID: Astragalus22_contig00019313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019313 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pr... 102 7e-26 gb|PNX73399.1| armadillo repeat-containing protein 7-like [Trifo... 103 2e-25 ref|XP_003616184.1| armadillo/beta-catenin-like repeat protein [... 103 2e-25 ref|XP_007141876.1| hypothetical protein PHAVU_008G233200g [Phas... 102 5e-25 ref|XP_017428395.1| PREDICTED: armadillo repeat-containing prote... 102 8e-25 ref|XP_004504996.1| PREDICTED: armadillo repeat-containing prote... 102 1e-24 ref|XP_020991227.1| armadillo repeat-containing protein 7 isofor... 100 4e-24 ref|XP_014503765.1| armadillo repeat-containing protein 7 isofor... 100 4e-24 ref|XP_016166046.1| armadillo repeat-containing protein 7 isofor... 100 6e-24 ref|XP_015931663.1| armadillo repeat-containing protein 7 [Arach... 100 6e-24 ref|XP_015950072.1| armadillo repeat-containing protein 7 isofor... 100 8e-24 ref|XP_012568504.1| PREDICTED: armadillo repeat-containing prote... 100 8e-24 ref|XP_020971740.1| armadillo repeat-containing protein 7-like i... 100 1e-23 ref|XP_016183736.1| armadillo repeat-containing protein 7-like i... 100 1e-23 dbj|GAU36768.1| hypothetical protein TSUD_213350 [Trifolium subt... 101 2e-23 ref|XP_020963052.1| armadillo repeat-containing protein 7 isofor... 98 5e-23 ref|XP_020963051.1| armadillo repeat-containing protein 7 isofor... 98 5e-23 ref|XP_006595559.1| PREDICTED: uncharacterized protein LOC100790... 97 7e-23 ref|NP_001242327.1| uncharacterized protein LOC100790639 [Glycin... 97 7e-23 ref|XP_019423564.1| PREDICTED: armadillo repeat-containing prote... 97 1e-22 >gb|PNX89220.1| armadillo repeat-containing protein [Trifolium pratense] Length = 94 Score = 102 bits (254), Expect = 7e-26 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALG +YYICNESNK EVLK EVIDVIKRYAAA +VSVSFSNLAKAFLDKHLSGN Sbjct: 38 VNYALGELYYICNESNKVEVLKPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSGN 94 >gb|PNX73399.1| armadillo repeat-containing protein 7-like [Trifolium pratense] Length = 177 Score = 103 bits (258), Expect = 2e-25 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNK EVLK EVIDVIKRYAAA +VSVSFSNLAKAFLDKHLSGN Sbjct: 121 VNYALGALYYVCNESNKVEVLKPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSGN 177 >ref|XP_003616184.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula] gb|AES99142.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula] gb|AFK40260.1| unknown [Medicago truncatula] Length = 178 Score = 103 bits (258), Expect = 2e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNESNKEEVLK EVIDVIKRYAAA +VSVSFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYICNESNKEEVLKPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSRN 177 >ref|XP_007141876.1| hypothetical protein PHAVU_008G233200g [Phaseolus vulgaris] gb|ESW13870.1| hypothetical protein PHAVU_008G233200g [Phaseolus vulgaris] Length = 178 Score = 102 bits (255), Expect = 5e-25 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNY LGA+YYICNE NKEE+LK EVID+I+RYAAA DVSVSFSNLAKAFLDKHLSGN Sbjct: 121 VNYTLGALYYICNEFNKEEILKPEVIDIIRRYAAAEDVSVSFSNLAKAFLDKHLSGN 177 >ref|XP_017428395.1| PREDICTED: armadillo repeat-containing protein 7-like isoform X1 [Vigna angularis] ref|XP_017428396.1| PREDICTED: armadillo repeat-containing protein 7-like isoform X1 [Vigna angularis] gb|KOM47012.1| hypothetical protein LR48_Vigan07g071600 [Vigna angularis] Length = 178 Score = 102 bits (254), Expect = 8e-25 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICN+ NKEE+LK EVID+IKRYAAA DVSVSFSNLAKAFL+KHLSGN Sbjct: 121 VNYALGALYYICNDFNKEEILKPEVIDIIKRYAAAEDVSVSFSNLAKAFLNKHLSGN 177 >ref|XP_004504996.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] ref|XP_004504997.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] ref|XP_012572496.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] Length = 177 Score = 102 bits (253), Expect = 1e-24 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNK+EVLK EV+DVIKRYA A +VSVSFSNLA+AFLDKHLSGN Sbjct: 121 VNYALGALYYVCNESNKKEVLKPEVVDVIKRYATAEEVSVSFSNLARAFLDKHLSGN 177 >ref|XP_020991227.1| armadillo repeat-containing protein 7 isoform X2 [Arachis duranensis] Length = 149 Score = 99.8 bits (247), Expect = 4e-24 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 93 VNYALGALYYVCNESNKEEILKPEVVDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 149 >ref|XP_014503765.1| armadillo repeat-containing protein 7 isoform X1 [Vigna radiata var. radiata] ref|XP_014503766.1| armadillo repeat-containing protein 7 isoform X1 [Vigna radiata var. radiata] ref|XP_022637712.1| armadillo repeat-containing protein 7 isoform X1 [Vigna radiata var. radiata] Length = 178 Score = 100 bits (249), Expect = 4e-24 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICN+ NK+E+LK EVID+IKRYAAA D+SVSFSNLAKAFL+KHLSGN Sbjct: 121 VNYALGALYYICNDFNKKEILKPEVIDIIKRYAAAEDISVSFSNLAKAFLNKHLSGN 177 >ref|XP_016166046.1| armadillo repeat-containing protein 7 isoform X1 [Arachis ipaensis] ref|XP_020963050.1| armadillo repeat-containing protein 7 isoform X1 [Arachis ipaensis] Length = 177 Score = 100 bits (248), Expect = 6e-24 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EVID IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYVCNESNKEEILKPEVIDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 177 >ref|XP_015931663.1| armadillo repeat-containing protein 7 [Arachis duranensis] ref|XP_020983182.1| armadillo repeat-containing protein 7 [Arachis duranensis] Length = 177 Score = 100 bits (248), Expect = 6e-24 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EVID IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYVCNESNKEEILKPEVIDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 177 >ref|XP_015950072.1| armadillo repeat-containing protein 7 isoform X1 [Arachis duranensis] ref|XP_016183737.1| armadillo repeat-containing protein 7-like isoform X3 [Arachis ipaensis] Length = 177 Score = 99.8 bits (247), Expect = 8e-24 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYVCNESNKEEILKPEVVDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 177 >ref|XP_012568504.1| PREDICTED: armadillo repeat-containing protein 7 [Cicer arietinum] Length = 177 Score = 99.8 bits (247), Expect = 8e-24 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNK+EVLK EV+DVIKRYA A +VSVSFSNLA+AFLDKH++GN Sbjct: 121 VNYALGALYYVCNESNKKEVLKPEVVDVIKRYATAEEVSVSFSNLARAFLDKHVAGN 177 >ref|XP_020971740.1| armadillo repeat-containing protein 7-like isoform X2 [Arachis ipaensis] Length = 186 Score = 99.8 bits (247), Expect = 1e-23 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 130 VNYALGALYYVCNESNKEEILKPEVVDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 186 >ref|XP_016183736.1| armadillo repeat-containing protein 7-like isoform X1 [Arachis ipaensis] Length = 186 Score = 99.8 bits (247), Expect = 1e-23 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YY+CNESNKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 130 VNYALGALYYVCNESNKEEILKPEVVDAIKRYAAAEEVSASFSNLAKAFLDKHLSEN 186 >dbj|GAU36768.1| hypothetical protein TSUD_213350 [Trifolium subterraneum] Length = 267 Score = 101 bits (251), Expect = 2e-23 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNESNK EVLK EVIDVIKRYAAA +VSVSFSNLAKAFLDKHLS N Sbjct: 211 VNYALGALYYICNESNKVEVLKPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHLSEN 267 >ref|XP_020963052.1| armadillo repeat-containing protein 7 isoform X3 [Arachis ipaensis] Length = 177 Score = 97.8 bits (242), Expect = 5e-23 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNE NKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYICNEFNKEEILKPEVVDTIKRYAAAEEVSASFSNLAKAFLDKHLSKN 177 >ref|XP_020963051.1| armadillo repeat-containing protein 7 isoform X2 [Arachis ipaensis] Length = 177 Score = 97.8 bits (242), Expect = 5e-23 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNE NKEE+LK EV+D IKRYAAA +VS SFSNLAKAFLDKHLS N Sbjct: 121 VNYALGALYYICNEFNKEEILKPEVVDTIKRYAAAEEVSASFSNLAKAFLDKHLSKN 177 >ref|XP_006595559.1| PREDICTED: uncharacterized protein LOC100790639 isoform X2 [Glycine max] ref|XP_006595560.1| PREDICTED: uncharacterized protein LOC100790639 isoform X2 [Glycine max] ref|XP_014621971.1| PREDICTED: uncharacterized protein LOC100790639 isoform X2 [Glycine max] gb|KHN39495.1| Armadillo repeat-containing protein 7 [Glycine soja] gb|KRH17284.1| hypothetical protein GLYMA_14G210900 [Glycine max] Length = 178 Score = 97.4 bits (241), Expect = 7e-23 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNESNKEE+L+ EV+DVI+RYAAA +VSVSFSNLAKAFL KHL+ N Sbjct: 121 VNYALGALYYICNESNKEEILRPEVVDVIRRYAAAEEVSVSFSNLAKAFLSKHLAEN 177 >ref|NP_001242327.1| uncharacterized protein LOC100790639 [Glycine max] gb|ACU24000.1| unknown [Glycine max] Length = 178 Score = 97.4 bits (241), Expect = 7e-23 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VNYALGA+YYICNESNKEE+L+ EV+DVI+RYAAA +VSVSFSNLAKAFL KHL+ N Sbjct: 121 VNYALGALYYICNESNKEEILRPEVVDVIRRYAAAEEVSVSFSNLAKAFLSKHLAEN 177 >ref|XP_019423564.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] ref|XP_019423565.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] ref|XP_019423566.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] gb|OIV93711.1| hypothetical protein TanjilG_16562 [Lupinus angustifolius] Length = 177 Score = 96.7 bits (239), Expect = 1e-22 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 391 VNYALGAVYYICNESNKEEVLKAEVIDVIKRYAAAADVSVSFSNLAKAFLDKHLSGN 221 VN ALGA+YY+CNESNK+EVLK EV+D+IKRY+ A +VS+SFSNLAKAFLDKHLSGN Sbjct: 121 VNSALGALYYVCNESNKDEVLKPEVVDLIKRYSVAEEVSLSFSNLAKAFLDKHLSGN 177