BLASTX nr result
ID: Astragalus22_contig00019234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00019234 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU35022.1| hypothetical protein TSUD_103450 [Trifolium subt... 53 5e-06 >dbj|GAU35022.1| hypothetical protein TSUD_103450 [Trifolium subterraneum] Length = 886 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 372 ASMSQTRLCSMVSANSRSELKERRVSGDVWLHATPE 265 +SMS TR C+M SA+S+S KE R+SGDVWLHA PE Sbjct: 819 SSMSHTRPCNMASASSKSNSKEWRMSGDVWLHAAPE 854 Score = 25.0 bits (53), Expect(2) = 5e-06 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 196 FNSYPNMRRELHLKFKF 146 ++ PN++RE H KFKF Sbjct: 870 YDCNPNIQREPHFKFKF 886