BLASTX nr result
ID: Astragalus22_contig00018993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00018993 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN18837.1| hypothetical protein glysoja_028206 [Glycine soja] 55 4e-07 gb|KHN04350.1| hypothetical protein glysoja_030944 [Glycine soja] 57 1e-06 >gb|KHN18837.1| hypothetical protein glysoja_028206 [Glycine soja] Length = 84 Score = 55.1 bits (131), Expect = 4e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -3 Query: 391 KVVFKGEVVNVKSIVMAIKYTAWSWFIARNGRNSGTLLSEWLNCPMGNLLSV 236 KV+FK E + ++ IK AW+WF+AR GR S W NCPMG LLS+ Sbjct: 33 KVIFKEEAAAIPVMISGIKDCAWAWFMARQGRTCWDGWSYWYNCPMGCLLSL 84 >gb|KHN04350.1| hypothetical protein glysoja_030944 [Glycine soja] Length = 229 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = -3 Query: 391 KVVFKGEVVNVKSIVMAIKYTAWSWFIARNGRNSGTLLSEWLNCPMGNLLSV 236 KV+FK E + ++ IK AW+WF+AR GR S+W NCPMG LLS+ Sbjct: 178 KVIFKEEAAAIPVMISGIKDCAWAWFMARQGRTCWDGWSDWYNCPMGCLLSL 229