BLASTX nr result
ID: Astragalus22_contig00018933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00018933 (792 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006589520.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-08 dbj|GAU32340.1| hypothetical protein TSUD_43820 [Trifolium subte... 65 3e-08 gb|KHN12930.1| Pentatricopeptide repeat-containing protein, chlo... 64 1e-07 gb|KYP74842.1| hypothetical protein KK1_007535 [Cajanus cajan] 62 2e-07 ref|XP_020232226.1| pentatricopeptide repeat-containing protein ... 62 3e-07 gb|OIW12537.1| hypothetical protein TanjilG_04701 [Lupinus angus... 61 6e-07 ref|XP_019442105.1| PREDICTED: pentatricopeptide repeat-containi... 61 6e-07 ref|XP_013469387.1| hypothetical protein MTR_1g492840 [Medicago ... 60 2e-06 ref|XP_012570062.1| PREDICTED: uncharacterized protein LOC101514... 60 2e-06 ref|XP_004496185.1| PREDICTED: uncharacterized protein LOC101514... 60 2e-06 ref|XP_013469388.1| hypothetical protein MTR_1g492840 [Medicago ... 60 2e-06 ref|XP_004496182.1| PREDICTED: uncharacterized protein LOC101514... 60 2e-06 ref|XP_004496516.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-06 ref|XP_003592182.1| pentatricopeptide (PPR) repeat protein [Medi... 59 4e-06 >ref|XP_006589520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic-like [Glycine max] gb|KRH35229.1| hypothetical protein GLYMA_10G230100 [Glycine max] Length = 881 Score = 65.9 bits (159), Expect = 2e-08 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV QA HLFDEM +RDVVSW T+LSAHTRNKH+F Sbjct: 56 NLLCLYAKCFGVGQARHLFDEMPHRDVVSWTTLLSAHTRNKHHF 99 >dbj|GAU32340.1| hypothetical protein TSUD_43820 [Trifolium subterraneum] Length = 630 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 +++ NL AK FGV+QA HLFDEM RDVVSW TVLS+HT+NKH+F Sbjct: 53 LYLTNNLLSLYAKCFGVHQARHLFDEMPDRDVVSWTTVLSSHTKNKHHF 101 >gb|KHN12930.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 610 Score = 63.5 bits (153), Expect = 1e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV A H FDEM +RDVVSW T+LSAHTRNKH+F Sbjct: 68 NLLSLYAKCFGVRHARHFFDEMPHRDVVSWTTLLSAHTRNKHHF 111 >gb|KYP74842.1| hypothetical protein KK1_007535 [Cajanus cajan] Length = 625 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV QA H FDEM ++DVVSW T+LSAHTRN H+F Sbjct: 56 NLLSLYAKCFGVRQARHFFDEMPHKDVVSWTTLLSAHTRNNHHF 99 >ref|XP_020232226.1| pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Cajanus cajan] Length = 853 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV QA H FDEM ++DVVSW T+LSAHTRN H+F Sbjct: 57 NLLSLYAKCFGVRQARHFFDEMPHKDVVSWTTLLSAHTRNNHHF 100 >gb|OIW12537.1| hypothetical protein TanjilG_04701 [Lupinus angustifolius] Length = 836 Score = 61.2 bits (147), Expect = 6e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV A HLFDEM YRDVVSW +LSAHTRNK +F Sbjct: 12 NLLSLYAKCFGVVTARHLFDEMPYRDVVSWTAILSAHTRNKQHF 55 >ref|XP_019442105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Lupinus angustifolius] Length = 888 Score = 61.2 bits (147), Expect = 6e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +1 Query: 187 NLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 NL AK FGV A HLFDEM YRDVVSW +LSAHTRNK +F Sbjct: 64 NLLSLYAKCFGVVTARHLFDEMPYRDVVSWTAILSAHTRNKQHF 107 >ref|XP_013469387.1| hypothetical protein MTR_1g492840 [Medicago truncatula] gb|KEH43425.1| hypothetical protein MTR_1g492840 [Medicago truncatula] Length = 644 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 574 SSIVQKHKVEPRGVYSSEELF*AETRDIMPKSYDDTRGYNNQ 449 +S Q+H EP GVYS EE+ +E RD+M KSYDDTRGYNNQ Sbjct: 316 TSEAQEHTSEPGGVYSPEEILKSEARDVMSKSYDDTRGYNNQ 357 >ref|XP_012570062.1| PREDICTED: uncharacterized protein LOC101514253 isoform X3 [Cicer arietinum] Length = 645 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 574 SSIVQKHKVEPRGVYSSEELF*AETRDIMPKSYDDTRGYNNQKS 443 +S Q+ K EP GV SSEE+F +E RD+MPKSYDDT YNNQ S Sbjct: 318 TSNAQEDKAEPGGVRSSEEIFKSEARDVMPKSYDDTSDYNNQNS 361 >ref|XP_004496185.1| PREDICTED: uncharacterized protein LOC101514253 isoform X2 [Cicer arietinum] Length = 660 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 574 SSIVQKHKVEPRGVYSSEELF*AETRDIMPKSYDDTRGYNNQKS 443 +S Q+ K EP GV SSEE+F +E RD+MPKSYDDT YNNQ S Sbjct: 333 TSNAQEDKAEPGGVRSSEEIFKSEARDVMPKSYDDTSDYNNQNS 376 >ref|XP_013469388.1| hypothetical protein MTR_1g492840 [Medicago truncatula] gb|KEH43426.1| hypothetical protein MTR_1g492840 [Medicago truncatula] Length = 662 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 574 SSIVQKHKVEPRGVYSSEELF*AETRDIMPKSYDDTRGYNNQ 449 +S Q+H EP GVYS EE+ +E RD+M KSYDDTRGYNNQ Sbjct: 334 TSEAQEHTSEPGGVYSPEEILKSEARDVMSKSYDDTRGYNNQ 375 >ref|XP_004496182.1| PREDICTED: uncharacterized protein LOC101514253 isoform X1 [Cicer arietinum] Length = 663 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 574 SSIVQKHKVEPRGVYSSEELF*AETRDIMPKSYDDTRGYNNQKS 443 +S Q+ K EP GV SSEE+F +E RD+MPKSYDDT YNNQ S Sbjct: 336 TSNAQEDKAEPGGVRSSEEIFKSEARDVMPKSYDDTSDYNNQNS 379 >ref|XP_004496516.1| PREDICTED: pentatricopeptide repeat-containing protein At5g52850, chloroplastic [Cicer arietinum] Length = 885 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHNF 318 +++ NL AK FGV QA FDEM Y+DVVSW TVLS+HT+N H+F Sbjct: 55 LYLTNNLLSLYAKCFGVFQARQFFDEMPYKDVVSWTTVLSSHTKNNHHF 103 >ref|XP_003592182.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES62433.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 912 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 172 VFVVLNLCDFDAK*FGVNQACHLFDEMSYRDVVSWGTVLSAHTRNKHN 315 +++ NL AK FGV++A HLFDEM RDVVSW T+LS+HT+ KH+ Sbjct: 49 LYLTNNLLSLYAKTFGVHRARHLFDEMPNRDVVSWTTILSSHTKTKHH 96