BLASTX nr result
ID: Astragalus22_contig00017869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017869 (330 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADR51749.1| pathogenesis related protein 5, partial [Malus hu... 87 8e-21 gb|PNX72878.1| hypothetical protein L195_g028776, partial [Trifo... 91 3e-20 dbj|GAU20346.1| hypothetical protein TSUD_338280 [Trifolium subt... 91 5e-20 ref|XP_003625706.2| allergen Pru protein, putative [Medicago tru... 90 1e-19 gb|AAS79334.1| thamatin-like PR5, partial [Malus domestica] 87 3e-19 sp|P83336.1|TP1B_MALDO RecName: Full=Thaumatin-like protein 1b; ... 87 6e-19 gb|AAM12886.1|AF494393_1 thaumatine-like protein, partial [Malus... 87 6e-19 pdb|3ZS3|A Chain A, High Resolution Structure Of Mal D 2, The Th... 87 7e-19 gb|AAC36740.1| thaumatin-like protein precursor Mdtl1 [Malus dom... 87 1e-18 dbj|BAM15892.1| putative thaumatin-like protein, partial [Pyrus ... 83 1e-18 gb|AAX19849.1| thaumatin-like protein precursor [Malus domestica... 87 1e-18 gb|AAX19847.1| thaumatin-like protein precursor [Malus domestica... 87 1e-18 ref|NP_001315714.1| thaumatin-like protein 1a precursor [Malus d... 87 1e-18 gb|ABC47923.1| pathogenesis-related protein 5 [Malus domestica] 87 1e-18 gb|AFK49127.1| unknown [Medicago truncatula] 87 1e-18 pir||JC7201 thaumatin-like protein 1 - apple tree 87 1e-18 ref|XP_008365751.1| PREDICTED: thaumatin-like protein 1a [Malus ... 87 1e-18 ref|XP_008381285.1| PREDICTED: thaumatin-like protein 1a [Malus ... 87 1e-18 ref|XP_004517306.1| PREDICTED: thaumatin-like protein 1b [Cicer ... 87 2e-18 gb|ABX89933.1| thaumatin-like protein 1 precursor, partial [Frag... 80 6e-18 >gb|ADR51749.1| pathogenesis related protein 5, partial [Malus hupehensis] Length = 43 Score = 87.4 bits (215), Expect = 8e-21 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 3 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 43 >gb|PNX72878.1| hypothetical protein L195_g028776, partial [Trifolium pratense] Length = 225 Score = 90.9 bits (224), Expect = 3e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PTQYSEIFEKQCPQAYSYAYDDK+STFTC KGPNYTITFCP Sbjct: 185 PTQYSEIFEKQCPQAYSYAYDDKSSTFTCFKGPNYTITFCP 225 >dbj|GAU20346.1| hypothetical protein TSUD_338280 [Trifolium subterraneum] Length = 242 Score = 90.9 bits (224), Expect = 5e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PTQYSEIFEKQCPQAYSYAYDDK+STFTC KGPNYTITFCP Sbjct: 202 PTQYSEIFEKQCPQAYSYAYDDKSSTFTCFKGPNYTITFCP 242 >ref|XP_003625706.2| allergen Pru protein, putative [Medicago truncatula] gb|AES81924.2| allergen Pru protein, putative [Medicago truncatula] Length = 243 Score = 89.7 bits (221), Expect = 1e-19 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PTQYS+IFEKQCPQAYSYAYDDK+STFTC KGPNYTITFCP Sbjct: 201 PTQYSDIFEKQCPQAYSYAYDDKSSTFTCFKGPNYTITFCP 241 >gb|AAS79334.1| thamatin-like PR5, partial [Malus domestica] Length = 182 Score = 87.4 bits (215), Expect = 3e-19 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 142 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 182 >sp|P83336.1|TP1B_MALDO RecName: Full=Thaumatin-like protein 1b; AltName: Full=Pathogenesis-related protein 5b; Short=PR-5b gb|AAM12887.1|AF494394_1 thaumatine-like protein, partial [Malus domestica] Length = 212 Score = 87.4 bits (215), Expect = 6e-19 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 172 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 212 >gb|AAM12886.1|AF494393_1 thaumatine-like protein, partial [Malus domestica] Length = 212 Score = 87.4 bits (215), Expect = 6e-19 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 172 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 212 >pdb|3ZS3|A Chain A, High Resolution Structure Of Mal D 2, The Thaumatin Like Food Allergen From Apple Length = 222 Score = 87.4 bits (215), Expect = 7e-19 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 182 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 222 >gb|AAC36740.1| thaumatin-like protein precursor Mdtl1 [Malus domestica] Length = 245 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 205 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 245 >dbj|BAM15892.1| putative thaumatin-like protein, partial [Pyrus pyrifolia var. culta] Length = 83 Score = 83.2 bits (204), Expect = 1e-18 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YS+ FE+QCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 43 PTEYSQFFEQQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 83 >gb|AAX19849.1| thaumatin-like protein precursor [Malus domestica] gb|AAX19850.1| thaumatin-like protein precursor [Malus domestica] gb|AAX19851.1| thaumatin-like protein precursor [Malus domestica] Length = 246 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 206 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246 >gb|AAX19847.1| thaumatin-like protein precursor [Malus domestica] gb|AAX19848.1| thaumatin-like protein precursor [Malus domestica] Length = 246 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 206 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246 >ref|NP_001315714.1| thaumatin-like protein 1a precursor [Malus domestica] sp|Q9FSG7.1|TP1A_MALDO RecName: Full=Thaumatin-like protein 1a; AltName: Full=Mdtl1; AltName: Full=Pathogenesis-related protein 5a; Short=PR-5a; AltName: Allergen=Mal d 2; Flags: Precursor emb|CAC10270.1| thaumatin-like protein [Malus domestica] gb|AAX19845.1| thaumatin-like protein precursor [Malus domestica] gb|AAX19846.1| thaumatin-like protein precursor [Malus domestica] Length = 246 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 206 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246 >gb|ABC47923.1| pathogenesis-related protein 5 [Malus domestica] Length = 246 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 206 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246 >gb|AFK49127.1| unknown [Medicago truncatula] Length = 247 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PTQY +IFEKQCPQAYSYAYDDK+STFTC KGPNYTITFCP Sbjct: 205 PTQYFDIFEKQCPQAYSYAYDDKSSTFTCFKGPNYTITFCP 245 >pir||JC7201 thaumatin-like protein 1 - apple tree Length = 247 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 207 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 247 >ref|XP_008365751.1| PREDICTED: thaumatin-like protein 1a [Malus domestica] Length = 248 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 208 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 248 >ref|XP_008381285.1| PREDICTED: thaumatin-like protein 1a [Malus domestica] Length = 248 Score = 87.4 bits (215), Expect = 1e-18 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT+YSEIFEKQCPQAYSYAYDDKNSTFTCS GP+Y ITFCP Sbjct: 208 PTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 248 >ref|XP_004517306.1| PREDICTED: thaumatin-like protein 1b [Cicer arietinum] Length = 246 Score = 86.7 bits (213), Expect = 2e-18 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PTQYS+IFE QCP AYSYAYDDK+STFTCS+GPNYTITFCP Sbjct: 206 PTQYSDIFENQCPDAYSYAYDDKSSTFTCSQGPNYTITFCP 246 >gb|ABX89933.1| thaumatin-like protein 1 precursor, partial [Fragaria x ananassa] Length = 54 Score = 80.5 bits (197), Expect = 6e-18 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +1 Query: 1 PTQYSEIFEKQCPQAYSYAYDDKNSTFTCSKGPNYTITFCP 123 PT YS+IFE QCPQAYSYAYDDKNS FTC GPNY ITFCP Sbjct: 14 PTNYSQIFEDQCPQAYSYAYDDKNSLFTCFGGPNYAITFCP 54