BLASTX nr result
ID: Astragalus22_contig00017829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017829 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK39691.1| unknown [Lotus japonicus] 58 2e-07 ref|XP_014513778.1| protein NRT1/ PTR FAMILY 5.2 [Vigna radiata ... 57 1e-06 ref|XP_017414788.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like... 57 1e-06 gb|OIW21320.1| hypothetical protein TanjilG_32133 [Lupinus angus... 55 3e-06 ref|XP_004495348.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like... 55 3e-06 ref|XP_007134672.1| hypothetical protein PHAVU_010G066200g [Phas... 55 3e-06 ref|XP_019432732.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like... 55 3e-06 dbj|GAU31622.1| hypothetical protein TSUD_63710 [Trifolium subte... 55 4e-06 gb|PNY02773.1| peptide transporter PTR3-a-like protein [Trifoliu... 54 1e-05 >gb|AFK39691.1| unknown [Lotus japonicus] Length = 246 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSN 104 +FF++V+RFYVY+AEVSDSIEVLA ELK KTVSN Sbjct: 207 IFFLVVSRFYVYKAEVSDSIEVLAKELKEKTVSN 240 >ref|XP_014513778.1| protein NRT1/ PTR FAMILY 5.2 [Vigna radiata var. radiata] Length = 594 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSN 104 +FF VTRFYVYR EVSDSI+VLA ELK KTVSN Sbjct: 555 IFFAFVTRFYVYRVEVSDSIDVLAKELKEKTVSN 588 >ref|XP_017414788.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Vigna angularis] gb|KOM35546.1| hypothetical protein LR48_Vigan02g169600 [Vigna angularis] dbj|BAT94764.1| hypothetical protein VIGAN_08139600 [Vigna angularis var. angularis] Length = 594 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSN 104 +FF VTRFYVYR EVSDSI+VLA ELK KTVSN Sbjct: 555 IFFAFVTRFYVYRVEVSDSIDVLAKELKEKTVSN 588 >gb|OIW21320.1| hypothetical protein TanjilG_32133 [Lupinus angustifolius] Length = 477 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTV 98 +FF IVTRFYVYRAEVSDSIE+LA ELK KTV Sbjct: 438 IFFYIVTRFYVYRAEVSDSIELLAKELKEKTV 469 >ref|XP_004495348.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cicer arietinum] Length = 591 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSNNM 110 +FF IVTRFYVYR EVSDSI+VLA ELK K +SN++ Sbjct: 552 IFFAIVTRFYVYRVEVSDSIQVLAKELKEKKMSNHV 587 >ref|XP_007134672.1| hypothetical protein PHAVU_010G066200g [Phaseolus vulgaris] gb|ESW06666.1| hypothetical protein PHAVU_010G066200g [Phaseolus vulgaris] Length = 594 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSN 104 +FF VT+FYVYR EVSDSI+VLA ELK KTVSN Sbjct: 555 IFFAFVTKFYVYRVEVSDSIDVLAKELKEKTVSN 588 >ref|XP_019432732.1| PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Lupinus angustifolius] Length = 601 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTV 98 +FF IVTRFYVYRAEVSDSIE+LA ELK KTV Sbjct: 562 IFFYIVTRFYVYRAEVSDSIELLAKELKEKTV 593 >dbj|GAU31622.1| hypothetical protein TSUD_63710 [Trifolium subterraneum] Length = 480 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSNNM 110 VFF IVTRFYVYR EVSDSI+VLA+ELK K ++N++ Sbjct: 441 VFFAIVTRFYVYRVEVSDSIQVLADELKEKKMANHV 476 >gb|PNY02773.1| peptide transporter PTR3-a-like protein [Trifolium pratense] gb|PNY03502.1| peptide transporter PTR3-a-like protein [Trifolium pratense] Length = 483 Score = 53.9 bits (128), Expect = 1e-05 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 VFFVIVTRFYVYRAEVSDSIEVLANELKVKTVSNNM 110 VFF IVTRFYVYR EVSDSI+VLA+ELK K + N++ Sbjct: 444 VFFAIVTRFYVYRVEVSDSIQVLADELKEKKMVNHV 479