BLASTX nr result
ID: Astragalus22_contig00017828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017828 (1824 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013441723.1| sucrose synthase [Medicago truncatula] >gi|6... 60 1e-05 >ref|XP_013441723.1| sucrose synthase [Medicago truncatula] gb|KEH15748.1| sucrose synthase [Medicago truncatula] Length = 759 Score = 60.5 bits (145), Expect = 1e-05 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +3 Query: 84 RQWDPGGCSLIYWEGTLQLKATWKETTST--QKHFPNSNLEDKVDFNGGGNVMIQLAR-- 251 +QWDPGGCSLI +G K TT+T Q ++ NLEDKVDF G GNVM R Sbjct: 676 KQWDPGGCSLICGQGLCDFSGYLKVTTTTTIQHYYFGFNLEDKVDFKGDGNVMSLRVRRG 735 Query: 252 ISGNR 266 I GNR Sbjct: 736 IMGNR 740