BLASTX nr result
ID: Astragalus22_contig00017592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017592 (325 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013448909.1| hypothetical protein MTR_7g062650 [Medicago ... 56 4e-07 gb|PNY03532.1| hypothetical protein L195_g026864 [Trifolium prat... 54 5e-06 >ref|XP_013448909.1| hypothetical protein MTR_7g062650 [Medicago truncatula] gb|KEH22936.1| hypothetical protein MTR_7g062650 [Medicago truncatula] Length = 183 Score = 55.8 bits (133), Expect = 4e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 229 VLHRKMIYKGSMLAPRVLLNWKILPPKHGTCFYLSLRTMIF 107 +LHRKMI GS+ A +VL+ WK LP KHGTC Y SLRT +F Sbjct: 132 ILHRKMINWGSVSALKVLIKWKTLPLKHGTCDYSSLRTRMF 172 >gb|PNY03532.1| hypothetical protein L195_g026864 [Trifolium pratense] Length = 400 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 229 VLHRKMIYKGSMLAPRVLLNWKILPPKHGTCFYLSLRTMIF 107 V HRKMI +G++ ++L+ WK LP KHGTC Y SLRT +F Sbjct: 350 VFHRKMINRGNVRDAKILIKWKTLPRKHGTCDYSSLRTRMF 390