BLASTX nr result
ID: Astragalus22_contig00017509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017509 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY16021.1| hypothetical protein L195_g012730 [Trifolium prat... 84 2e-17 dbj|GAU32874.1| hypothetical protein TSUD_210950 [Trifolium subt... 84 2e-17 ref|XP_020205887.1| calcium uniporter protein 2, mitochondrial-l... 84 4e-16 ref|XP_003629496.1| PPR containing plant-like protein [Medicago ... 82 2e-15 ref|XP_004509238.1| PREDICTED: calcium uniporter protein 2, mito... 80 8e-15 ref|XP_014509734.1| calcium uniporter protein 2, mitochondrial-l... 78 5e-14 ref|XP_019444734.1| PREDICTED: calcium uniporter protein 2, mito... 77 9e-14 gb|ACU23756.1| unknown [Glycine max] 73 1e-13 ref|XP_003548898.2| PREDICTED: calcium uniporter protein 2, mito... 76 2e-13 gb|KHN00565.1| Calcium uniporter protein, mitochondrial [Glycine... 73 4e-13 ref|XP_019446773.1| PREDICTED: calcium uniporter protein 2, mito... 75 7e-13 ref|XP_019421786.1| PREDICTED: calcium uniporter protein 2, mito... 75 8e-13 ref|XP_003518051.1| PREDICTED: calcium uniporter protein 2, mito... 73 2e-12 ref|XP_019424339.1| PREDICTED: calcium uniporter protein 2, mito... 73 4e-12 gb|KHN42015.1| Calcium uniporter protein, mitochondrial [Glycine... 72 5e-12 ref|XP_003537504.1| PREDICTED: calcium uniporter protein 2, mito... 72 5e-12 gb|KRH28602.1| hypothetical protein GLYMA_11G063700 [Glycine max] 72 5e-12 ref|XP_017410623.1| PREDICTED: calcium uniporter protein 2, mito... 72 9e-12 gb|KRH76875.1| hypothetical protein GLYMA_01G178500 [Glycine max] 69 3e-11 ref|XP_003517254.1| PREDICTED: calcium uniporter protein 2, mito... 69 6e-11 >gb|PNY16021.1| hypothetical protein L195_g012730 [Trifolium pratense] Length = 159 Score = 84.0 bits (206), Expect = 2e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDS 322 KEPCFEGFYQSRFSTKQKRLMKLHNFDI+RYNQLR AS SSE +S Sbjct: 99 KEPCFEGFYQSRFSTKQKRLMKLHNFDIARYNQLRDASPLASSSELNS 146 >dbj|GAU32874.1| hypothetical protein TSUD_210950 [Trifolium subterraneum] Length = 159 Score = 84.0 bits (206), Expect = 2e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDS 322 KEPCFEGFYQSRFSTKQKRLMKLHNFDI+RYNQLR AS SSE +S Sbjct: 99 KEPCFEGFYQSRFSTKQKRLMKLHNFDIARYNQLRDASPLASSSELNS 146 >ref|XP_020205887.1| calcium uniporter protein 2, mitochondrial-like isoform X1 [Cajanus cajan] gb|KYP36004.1| Coiled-coil domain-containing protein 109A family [Cajanus cajan] Length = 331 Score = 83.6 bits (205), Expect = 4e-16 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQV-PSSEFDSFN 316 KEPCFEGFYQSRFST QKRLMKLHNFDI+RYN+LRA++ + PS EFDS N Sbjct: 269 KEPCFEGFYQSRFSTHQKRLMKLHNFDIARYNELRASAPPLPPSPEFDSSN 319 >ref|XP_003629496.1| PPR containing plant-like protein [Medicago truncatula] gb|AET03972.1| PPR containing plant-like protein [Medicago truncatula] Length = 349 Score = 82.0 bits (201), Expect = 2e-15 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDS 322 KEP FEGFYQSRFSTKQK+LMKLHNFDI+RYNQLR AS PSSE +S Sbjct: 289 KEPSFEGFYQSRFSTKQKQLMKLHNFDIARYNQLRDASPPAPSSELNS 336 >ref|XP_004509238.1| PREDICTED: calcium uniporter protein 2, mitochondrial [Cicer arietinum] Length = 337 Score = 80.1 bits (196), Expect = 8e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDS 322 KEP FEGFYQSRFSTKQKRLMKL+NFDI RYNQLR AS PSSE +S Sbjct: 277 KEPSFEGFYQSRFSTKQKRLMKLNNFDIERYNQLRDASPLAPSSELNS 324 >ref|XP_014509734.1| calcium uniporter protein 2, mitochondrial-like isoform X1 [Vigna radiata var. radiata] Length = 327 Score = 77.8 bits (190), Expect = 5e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDS 322 KEPCFEGFYQSRF++KQKRLMKLHNFDI RY +L+AA PS + DS Sbjct: 266 KEPCFEGFYQSRFASKQKRLMKLHNFDIGRYKELKAAVPSPPSYQIDS 313 >ref|XP_019444734.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] gb|OIW10985.1| hypothetical protein TanjilG_22792 [Lupinus angustifolius] Length = 354 Score = 77.4 bits (189), Expect = 9e-14 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSF 319 KEP FEGFYQ+RF TKQKRLMKLHNFD +YN+LRAA SQ +FDSF Sbjct: 284 KEPSFEGFYQARFRTKQKRLMKLHNFDTEKYNELRAACSQSTLPKFDSF 332 >gb|ACU23756.1| unknown [Glycine max] Length = 131 Score = 73.2 bits (178), Expect = 1e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSFNK 313 KEPCFEGFYQSRFS+KQK LMKLHNFDI RYN+LRA + PSS K Sbjct: 82 KEPCFEGFYQSRFSSKQKSLMKLHNFDIQRYNELRAKAP--PSSSIIGHKK 130 >ref|XP_003548898.2| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Glycine max] gb|KRH08320.1| hypothetical protein GLYMA_16G142100 [Glycine max] Length = 367 Score = 76.3 bits (186), Expect = 2e-13 Identities = 39/61 (63%), Positives = 45/61 (73%), Gaps = 8/61 (13%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQL--RAASSQVPSS------EFDSFNKE 310 KEPCFEGFYQSRFS+KQKRLMKLHNFDI RYN+L +A PSS + D F+K+ Sbjct: 307 KEPCFEGFYQSRFSSKQKRLMKLHNFDIERYNELWAKAPPPSAPSSSIIDPYQLDQFHKK 366 Query: 309 L 307 L Sbjct: 367 L 367 >gb|KHN00565.1| Calcium uniporter protein, mitochondrial [Glycine soja] Length = 184 Score = 73.2 bits (178), Expect = 4e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSFNK 313 KEPCFEGFYQSRFS+KQK LMKLHNFDI RYN+LRA + PSS K Sbjct: 135 KEPCFEGFYQSRFSSKQKSLMKLHNFDIQRYNELRAKAP--PSSSIIGHKK 183 >ref|XP_019446773.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] ref|XP_019446774.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] gb|OIW09728.1| hypothetical protein TanjilG_09401 [Lupinus angustifolius] Length = 328 Score = 74.7 bits (182), Expect = 7e-13 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSFNKEL 307 KEP FE FYQSRFSTKQK MKLHNFDISRYNQLRAASS S + F+K L Sbjct: 278 KEPSFEAFYQSRFSTKQKHQMKLHNFDISRYNQLRAASSF--SQPLNKFHKNL 328 >ref|XP_019421786.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] gb|OIV94773.1| hypothetical protein TanjilG_12986 [Lupinus angustifolius] Length = 345 Score = 74.7 bits (182), Expect = 8e-13 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSF 319 KEP FEGFYQ+RFSTKQKRLMKLHNFDI +YN+LRA S + DSF Sbjct: 285 KEPSFEGFYQARFSTKQKRLMKLHNFDIGKYNELRALCSPSTLPKLDSF 333 >ref|XP_003518051.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like isoform X1 [Glycine max] gb|KRH69955.1| hypothetical protein GLYMA_02G059200 [Glycine max] Length = 316 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFDSFNK 313 KEPCFEGFYQSRFS+KQK LMKLHNFDI RYN+LRA + PSS K Sbjct: 267 KEPCFEGFYQSRFSSKQKSLMKLHNFDIQRYNELRAKAP--PSSSIIGHKK 315 >ref|XP_019424339.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] ref|XP_019424340.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Lupinus angustifolius] gb|OIV92904.1| hypothetical protein TanjilG_01038 [Lupinus angustifolius] Length = 335 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASSQVPSSEFD 325 KEP FEGFYQ+RFSTKQKRLM++HNFD +YN+LRAA S +S FD Sbjct: 283 KEPSFEGFYQTRFSTKQKRLMRVHNFDTVKYNELRAACSPSTTSNFD 329 >gb|KHN42015.1| Calcium uniporter protein, mitochondrial [Glycine soja] Length = 324 Score = 72.4 bits (176), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS 349 KEP FEGFYQ+RFS+KQKRLMKLHNFDI +YNQLRAA S Sbjct: 263 KEPSFEGFYQARFSSKQKRLMKLHNFDIEKYNQLRAACS 301 >ref|XP_003537504.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Glycine max] gb|KRH28601.1| hypothetical protein GLYMA_11G063700 [Glycine max] Length = 324 Score = 72.4 bits (176), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS 349 KEP FEGFYQ+RFS+KQKRLMKLHNFDI +YNQLRAA S Sbjct: 263 KEPSFEGFYQARFSSKQKRLMKLHNFDIEKYNQLRAACS 301 >gb|KRH28602.1| hypothetical protein GLYMA_11G063700 [Glycine max] Length = 335 Score = 72.4 bits (176), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS 349 KEP FEGFYQ+RFS+KQKRLMKLHNFDI +YNQLRAA S Sbjct: 274 KEPSFEGFYQARFSSKQKRLMKLHNFDIEKYNQLRAACS 312 >ref|XP_017410623.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Vigna angularis] gb|KOM32323.1| hypothetical protein LR48_Vigan01g187900 [Vigna angularis] dbj|BAT75500.1| hypothetical protein VIGAN_01337200 [Vigna angularis var. angularis] Length = 329 Score = 71.6 bits (174), Expect = 9e-12 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -3 Query: 462 EPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS--QVPSSEFDS 322 EPCFEGFYQSRF++KQKRLMKLHNFDI RY +L+AA++ PS + D+ Sbjct: 267 EPCFEGFYQSRFTSKQKRLMKLHNFDIDRYKELKAAAAPPSPPSFQIDT 315 >gb|KRH76875.1| hypothetical protein GLYMA_01G178500 [Glycine max] Length = 257 Score = 69.3 bits (168), Expect = 3e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS 349 KEP FEGFYQ RFS+KQK LMKLHNFDI +YNQLRAA S Sbjct: 196 KEPSFEGFYQVRFSSKQKHLMKLHNFDIEKYNQLRAACS 234 >ref|XP_003517254.1| PREDICTED: calcium uniporter protein 2, mitochondrial-like [Glycine max] gb|KHN36152.1| Calcium uniporter protein, mitochondrial [Glycine soja] gb|KRH76874.1| hypothetical protein GLYMA_01G178500 [Glycine max] Length = 324 Score = 69.3 bits (168), Expect = 6e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 465 KEPCFEGFYQSRFSTKQKRLMKLHNFDISRYNQLRAASS 349 KEP FEGFYQ RFS+KQK LMKLHNFDI +YNQLRAA S Sbjct: 263 KEPSFEGFYQVRFSSKQKHLMKLHNFDIEKYNQLRAACS 301