BLASTX nr result
ID: Astragalus22_contig00017491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017491 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU21247.1| hypothetical protein TSUD_11660 [Trifolium subte... 54 7e-06 >dbj|GAU21247.1| hypothetical protein TSUD_11660 [Trifolium subterraneum] Length = 643 Score = 54.3 bits (129), Expect = 7e-06 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +2 Query: 194 EGGAQITG-HKLSDRISGISDFDFALKIGRETAYVLLPYFLLRFTLGFIVLFSLLTYTFR 370 +G QI G K S+ + D A++IGR T LLP + RF LG +V F LL YT+R Sbjct: 231 KGVVQIFGITKSSESTEAVLDSKTAIEIGRVTGRYLLPILVSRFVLGLLVFFVLLIYTYR 290 Query: 371 RRHISI 388 +RHIS+ Sbjct: 291 KRHISM 296