BLASTX nr result
ID: Astragalus22_contig00017369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00017369 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX77135.1| putative inositol transporter 2-like protein [Tri... 119 9e-33 dbj|GAU42285.1| hypothetical protein TSUD_81940, partial [Trifol... 119 1e-32 gb|PNX90890.1| putative inositol transporter 2-like protein, par... 115 3e-31 dbj|GAU42288.1| hypothetical protein TSUD_81970, partial [Trifol... 113 2e-30 ref|XP_004488281.1| PREDICTED: probable inositol transporter 2 i... 123 3e-30 ref|XP_016189180.1| probable inositol transporter 2 [Arachis ipa... 123 5e-30 ref|XP_015954878.1| probable inositol transporter 2 [Arachis dur... 123 5e-30 ref|XP_019415532.1| PREDICTED: probable inositol transporter 2 [... 122 9e-30 ref|XP_020227147.1| probable inositol transporter 2 isoform X1 [... 122 9e-30 ref|XP_015954962.1| probable inositol transporter 2 isoform X1 [... 122 1e-29 gb|PNY01906.1| putative inositol transporter 2-like protein, par... 119 3e-29 ref|XP_020240526.1| probable inositol transporter 2 [Cajanus caj... 120 3e-29 ref|XP_014505820.1| probable inositol transporter 2 [Vigna radia... 120 6e-29 ref|XP_017422923.1| PREDICTED: probable inositol transporter 2 [... 120 6e-29 ref|XP_007158767.1| hypothetical protein PHAVU_002G180200g [Phas... 120 6e-29 ref|XP_012572390.1| PREDICTED: probable inositol transporter 2 [... 120 6e-29 ref|XP_014617510.1| PREDICTED: probable inositol transporter 2 i... 119 7e-29 ref|NP_001348123.1| putative inositol transporter [Glycine max] ... 119 8e-29 ref|XP_016189182.1| probable inositol transporter 2 isoform X1 [... 119 9e-29 ref|XP_007138519.1| hypothetical protein PHAVU_009G216100g [Phas... 119 1e-28 >gb|PNX77135.1| putative inositol transporter 2-like protein [Trifolium pratense] Length = 69 Score = 119 bits (298), Expect = 9e-33 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFRECL+LSWKNPYVLRLAFSAGIGG LFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADVSAFRECLSLSWKNPYVLRLAFSAGIGGFLFGYDTGVISGALLYIRDDFKA 60 >dbj|GAU42285.1| hypothetical protein TSUD_81940, partial [Trifolium subterraneum] Length = 68 Score = 119 bits (297), Expect = 1e-32 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVP+AD+SAFRECL+LSWKNPY+LRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPKADISAFRECLSLSWKNPYILRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >gb|PNX90890.1| putative inositol transporter 2-like protein, partial [Trifolium pratense] gb|PNY01048.1| putative inositol transporter 2-like protein, partial [Trifolium pratense] Length = 68 Score = 115 bits (288), Expect = 3e-31 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 406 MEGGV EAD+SAFRECL+LSWKNPYVLRLAFSAGIGG LFGYDTGVISGALLYIRDDFK Sbjct: 1 MEGGVVEADVSAFRECLSLSWKNPYVLRLAFSAGIGGFLFGYDTGVISGALLYIRDDFK 59 >dbj|GAU42288.1| hypothetical protein TSUD_81970, partial [Trifolium subterraneum] Length = 68 Score = 113 bits (282), Expect = 2e-30 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 406 MEGG EAD SAFRECL+LSWKNPYVLRLAFSAGIGG LFGYDTGVISGALLYIRDDFK Sbjct: 1 MEGGAVEADASAFRECLSLSWKNPYVLRLAFSAGIGGFLFGYDTGVISGALLYIRDDFK 59 >ref|XP_004488281.1| PREDICTED: probable inositol transporter 2 isoform X1 [Cicer arietinum] Length = 569 Score = 123 bits (309), Expect = 3e-30 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEADMSAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS Sbjct: 1 MEGGVPEADMSAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 60 >ref|XP_016189180.1| probable inositol transporter 2 [Arachis ipaensis] ref|XP_016189181.1| probable inositol transporter 2 [Arachis ipaensis] Length = 573 Score = 123 bits (308), Expect = 5e-30 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGG+PEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGIPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_015954878.1| probable inositol transporter 2 [Arachis duranensis] Length = 573 Score = 123 bits (308), Expect = 5e-30 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGG+PEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGIPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_019415532.1| PREDICTED: probable inositol transporter 2 [Lupinus angustifolius] Length = 572 Score = 122 bits (306), Expect = 9e-30 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEADMSAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADMSAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_020227147.1| probable inositol transporter 2 isoform X1 [Cajanus cajan] ref|XP_020227201.1| probable inositol transporter 2 isoform X1 [Cajanus cajan] gb|KYP54460.1| putative inositol transporter 2 [Cajanus cajan] gb|KYP54463.1| putative inositol transporter 2 [Cajanus cajan] Length = 572 Score = 122 bits (306), Expect = 9e-30 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEADMSAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADMSAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_015954962.1| probable inositol transporter 2 isoform X1 [Arachis duranensis] Length = 587 Score = 122 bits (305), Expect = 1e-29 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADVSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >gb|PNY01906.1| putative inositol transporter 2-like protein, partial [Trifolium pratense] Length = 415 Score = 119 bits (298), Expect = 3e-29 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVP+AD+SAFRECL+LSWKNPY+LRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPDADISAFRECLSLSWKNPYILRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_020240526.1| probable inositol transporter 2 [Cajanus cajan] gb|KYP41090.1| putative inositol transporter 2 [Cajanus cajan] Length = 571 Score = 120 bits (302), Expect = 3e-29 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADISAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_014505820.1| probable inositol transporter 2 [Vigna radiata var. radiata] Length = 568 Score = 120 bits (300), Expect = 6e-29 Identities = 56/59 (94%), Positives = 59/59 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 406 MEGGVPEAD+SAFRECL+LSWKNPY+LRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK Sbjct: 1 MEGGVPEADVSAFRECLSLSWKNPYILRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 59 >ref|XP_017422923.1| PREDICTED: probable inositol transporter 2 [Vigna angularis] gb|KOM43327.1| hypothetical protein LR48_Vigan05g093100 [Vigna angularis] dbj|BAT74295.1| hypothetical protein VIGAN_01193500 [Vigna angularis var. angularis] Length = 568 Score = 120 bits (300), Expect = 6e-29 Identities = 56/59 (94%), Positives = 59/59 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 406 MEGGVPEAD+SAFRECL+LSWKNPY+LRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK Sbjct: 1 MEGGVPEADVSAFRECLSLSWKNPYILRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 59 >ref|XP_007158767.1| hypothetical protein PHAVU_002G180200g [Phaseolus vulgaris] gb|ESW30761.1| hypothetical protein PHAVU_002G180200g [Phaseolus vulgaris] Length = 569 Score = 120 bits (300), Expect = 6e-29 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFREC++LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADVSAFRECISLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_012572390.1| PREDICTED: probable inositol transporter 2 [Cicer arietinum] Length = 572 Score = 120 bits (300), Expect = 6e-29 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFREC++LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADISAFRECMSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_014617510.1| PREDICTED: probable inositol transporter 2 isoform X2 [Glycine max] Length = 469 Score = 119 bits (297), Expect = 7e-29 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK 406 MEGGVPEAD+SAFRECL+LSWKNPYVLRLAFSAGIGG LFGYDTGVISGALLYIRDDFK Sbjct: 1 MEGGVPEADISAFRECLSLSWKNPYVLRLAFSAGIGGFLFGYDTGVISGALLYIRDDFK 59 >ref|NP_001348123.1| putative inositol transporter [Glycine max] gb|KHN05290.1| Putative inositol transporter 2 [Glycine soja] gb|KRH12789.1| hypothetical protein GLYMA_15G194600 [Glycine max] gb|KRH12790.1| hypothetical protein GLYMA_15G194600 [Glycine max] Length = 573 Score = 119 bits (299), Expect = 8e-29 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEADMSAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYI+D+FK+ Sbjct: 1 MEGGVPEADMSAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIKDEFKA 60 >ref|XP_016189182.1| probable inositol transporter 2 isoform X1 [Arachis ipaensis] Length = 586 Score = 119 bits (299), Expect = 9e-29 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+ AFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFK+ Sbjct: 1 MEGGVPEADVFAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKA 60 >ref|XP_007138519.1| hypothetical protein PHAVU_009G216100g [Phaseolus vulgaris] gb|ESW10513.1| hypothetical protein PHAVU_009G216100g [Phaseolus vulgaris] Length = 571 Score = 119 bits (298), Expect = 1e-28 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +2 Query: 230 MEGGVPEADMSAFRECLALSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKS 409 MEGGVPEAD+SAFRECL+LSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRD+FK+ Sbjct: 1 MEGGVPEADISAFRECLSLSWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDEFKA 60