BLASTX nr result
ID: Astragalus22_contig00016557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00016557 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU25404.1| hypothetical protein TSUD_70560 [Trifolium subte... 59 6e-07 >dbj|GAU25404.1| hypothetical protein TSUD_70560 [Trifolium subterraneum] Length = 519 Score = 58.5 bits (140), Expect = 6e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 107 LFNPHSLFKTRHFSSETVSPTQTLSNEPDPIARSL 3 LF PHSLF+T+HFSSE+VS T+ LS+EPDPIAR+L Sbjct: 50 LFTPHSLFQTKHFSSESVSTTEKLSDEPDPIARAL 84