BLASTX nr result
ID: Astragalus22_contig00016445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00016445 (319 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT95039.1| hypothetical protein VIGAN_08169700 [Vigna angul... 73 2e-13 ref|XP_017438749.1| PREDICTED: uncharacterized protein LOC108344... 73 5e-13 ref|XP_017438748.1| PREDICTED: uncharacterized protein LOC108344... 73 6e-13 ref|XP_017438747.1| PREDICTED: uncharacterized protein LOC108344... 73 6e-13 ref|XP_014513288.1| uncharacterized protein LOC106771815 [Vigna ... 72 9e-13 ref|XP_015939869.1| uncharacterized protein LOC107465407 [Arachi... 71 2e-12 dbj|GAU42792.1| hypothetical protein TSUD_34360 [Trifolium subte... 68 5e-12 ref|XP_016177340.1| uncharacterized protein LOC107619563 isoform... 69 9e-12 ref|XP_020967109.1| uncharacterized protein LOC107619563 isoform... 69 9e-12 ref|XP_020967108.1| uncharacterized protein LOC107619563 isoform... 69 9e-12 gb|PNY11145.1| amidase 1-like, partial [Trifolium pratense] 69 3e-11 gb|ACU13991.1| unknown [Glycine max] 67 4e-11 ref|NP_001236333.2| RING zinc finger-containing protein [Glycine... 67 7e-11 gb|KHN16135.1| E3 ubiquitin-protein ligase Topors [Glycine soja] 67 9e-11 ref|XP_003536087.1| PREDICTED: E3 ubiquitin-protein ligase Topor... 67 9e-11 ref|XP_004495738.1| PREDICTED: uncharacterized protein LOC101505... 66 2e-10 ref|XP_004495737.1| PREDICTED: uncharacterized protein LOC101505... 66 2e-10 ref|XP_011466311.1| PREDICTED: uncharacterized protein LOC101298... 65 3e-10 ref|XP_007144744.1| hypothetical protein PHAVU_007G181000g [Phas... 64 6e-10 gb|AGV54831.1| hypothetical protein [Phaseolus vulgaris] 64 6e-10 >dbj|BAT95039.1| hypothetical protein VIGAN_08169700 [Vigna angularis var. angularis] Length = 204 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+SRKY+QPNSWL SWL REIQ LIQE+ Sbjct: 50 LDDIFNISQYWRSRKYSQPNSWLESWLRREIQALIQEE 87 >ref|XP_017438749.1| PREDICTED: uncharacterized protein LOC108344770 isoform X3 [Vigna angularis] Length = 278 Score = 72.8 bits (177), Expect = 5e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+SRKY+QPNSWL SWL REIQ LIQE+ Sbjct: 123 LDDIFNISQYWRSRKYSQPNSWLESWLRREIQALIQEE 160 >ref|XP_017438748.1| PREDICTED: uncharacterized protein LOC108344770 isoform X2 [Vigna angularis] Length = 300 Score = 72.8 bits (177), Expect = 6e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+SRKY+QPNSWL SWL REIQ LIQE+ Sbjct: 146 LDDIFNISQYWRSRKYSQPNSWLESWLRREIQALIQEE 183 >ref|XP_017438747.1| PREDICTED: uncharacterized protein LOC108344770 isoform X1 [Vigna angularis] Length = 301 Score = 72.8 bits (177), Expect = 6e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+SRKY+QPNSWL SWL REIQ LIQE+ Sbjct: 146 LDDIFNISQYWRSRKYSQPNSWLESWLRREIQALIQEE 183 >ref|XP_014513288.1| uncharacterized protein LOC106771815 [Vigna radiata var. radiata] Length = 278 Score = 72.0 bits (175), Expect = 9e-13 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+SRKY+QPNSWL SW+ REIQ LIQE+ Sbjct: 123 LDDIFNISQYWRSRKYSQPNSWLESWMRREIQALIQEE 160 >ref|XP_015939869.1| uncharacterized protein LOC107465407 [Arachis duranensis] Length = 269 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDD+FNIS YWKSRKY QPNSWL SWL REIQ LIQE+ Sbjct: 123 LDDVFNISHYWKSRKYCQPNSWLQSWLRREIQALIQEE 160 >dbj|GAU42792.1| hypothetical protein TSUD_34360 [Trifolium subterraneum] Length = 161 Score = 68.2 bits (165), Expect = 5e-12 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 L+DIFNI QYWKSRKY QPN+WL +WLTREIQ L QE+ Sbjct: 7 LEDIFNIPQYWKSRKYNQPNNWLQTWLTREIQALTQEE 44 >ref|XP_016177340.1| uncharacterized protein LOC107619563 isoform X3 [Arachis ipaensis] Length = 277 Score = 69.3 bits (168), Expect = 9e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDD+FNIS YWKSRKY QPNSWL WL REIQ LIQE+ Sbjct: 123 LDDVFNISHYWKSRKYCQPNSWLQGWLRREIQALIQEE 160 >ref|XP_020967109.1| uncharacterized protein LOC107619563 isoform X2 [Arachis ipaensis] Length = 280 Score = 69.3 bits (168), Expect = 9e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDD+FNIS YWKSRKY QPNSWL WL REIQ LIQE+ Sbjct: 127 LDDVFNISHYWKSRKYCQPNSWLQGWLRREIQALIQEE 164 >ref|XP_020967108.1| uncharacterized protein LOC107619563 isoform X1 [Arachis ipaensis] Length = 281 Score = 69.3 bits (168), Expect = 9e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDD+FNIS YWKSRKY QPNSWL WL REIQ LIQE+ Sbjct: 127 LDDVFNISHYWKSRKYCQPNSWLQGWLRREIQALIQEE 164 >gb|PNY11145.1| amidase 1-like, partial [Trifolium pratense] Length = 630 Score = 68.6 bits (166), Expect = 3e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQRLRL 127 L+DIFNI QYWKSRKY QPN+WL +WLTREIQ L QE+ + + Sbjct: 22 LEDIFNIPQYWKSRKYNQPNNWLQTWLTREIQALTQEEDVNI 63 >gb|ACU13991.1| unknown [Glycine max] Length = 228 Score = 67.0 bits (162), Expect = 4e-11 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 +DDIFNISQYW+S+KY QPN WL SWL REIQ LIQE+ Sbjct: 124 VDDIFNISQYWRSQKYYQPNCWLESWLRREIQALIQEE 161 >ref|NP_001236333.2| RING zinc finger-containing protein [Glycine max] gb|KHN20210.1| E3 ubiquitin-protein ligase Topors [Glycine soja] gb|KRG92835.1| hypothetical protein GLYMA_20G232800 [Glycine max] Length = 279 Score = 67.0 bits (162), Expect = 7e-11 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 +DDIFNISQYW+S+KY QPN WL SWL REIQ LIQE+ Sbjct: 124 VDDIFNISQYWRSQKYYQPNCWLQSWLRREIQALIQEE 161 >gb|KHN16135.1| E3 ubiquitin-protein ligase Topors [Glycine soja] Length = 281 Score = 66.6 bits (161), Expect = 9e-11 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+S KY QPN WL +WL REIQ LIQE+ Sbjct: 126 LDDIFNISQYWRSLKYNQPNCWLENWLRREIQALIQEE 163 >ref|XP_003536087.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Glycine max] gb|KRH33961.1| hypothetical protein GLYMA_10G155500 [Glycine max] Length = 281 Score = 66.6 bits (161), Expect = 9e-11 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LDDIFNISQYW+S KY QPN WL +WL REIQ LIQE+ Sbjct: 126 LDDIFNISQYWRSLKYNQPNCWLENWLRREIQALIQEE 163 >ref|XP_004495738.1| PREDICTED: uncharacterized protein LOC101505864 isoform X2 [Cicer arietinum] Length = 270 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 L+DIFNI QYWKS KY QPN+WL SWLTREIQ L QE+ Sbjct: 117 LEDIFNILQYWKSCKYNQPNNWLQSWLTREIQALTQEE 154 >ref|XP_004495737.1| PREDICTED: uncharacterized protein LOC101505864 isoform X1 [Cicer arietinum] ref|XP_012569969.1| PREDICTED: uncharacterized protein LOC101505864 isoform X1 [Cicer arietinum] Length = 271 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 L+DIFNI QYWKS KY QPN+WL SWLTREIQ L QE+ Sbjct: 117 LEDIFNILQYWKSCKYNQPNNWLQSWLTREIQALTQEE 154 >ref|XP_011466311.1| PREDICTED: uncharacterized protein LOC101298921 [Fragaria vesca subsp. vesca] Length = 274 Score = 65.1 bits (157), Expect = 3e-10 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQRLRL 127 LDDIF++SQYWKS KY QPN WL SWL REIQ L+QE+ + + Sbjct: 121 LDDIFDVSQYWKSCKYLQPNCWLQSWLRREIQALMQEEDVEI 162 >ref|XP_007144744.1| hypothetical protein PHAVU_007G181000g [Phaseolus vulgaris] gb|ESW16738.1| hypothetical protein PHAVU_007G181000g [Phaseolus vulgaris] Length = 278 Score = 64.3 bits (155), Expect = 6e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LD++FNISQYW+SR Y +PN WL SWL REIQ LIQE+ Sbjct: 123 LDEVFNISQYWRSRMYLRPNCWLESWLRREIQALIQEE 160 >gb|AGV54831.1| hypothetical protein [Phaseolus vulgaris] Length = 278 Score = 64.3 bits (155), Expect = 6e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 2 LDDIFNISQYWKSRKYTQPNSWL*SWLTREIQVLIQEQ 115 LD++FNISQYW+SR Y +PN WL SWL REIQ LIQE+ Sbjct: 123 LDEVFNISQYWRSRMYLRPNCWLESWLRREIQALIQEE 160