BLASTX nr result
ID: Astragalus22_contig00016296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00016296 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44447.1| hypothetical protein TSUD_93010 [Trifolium subte... 55 4e-06 >dbj|GAU44447.1| hypothetical protein TSUD_93010 [Trifolium subterraneum] Length = 466 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -2 Query: 371 IELVRFLLENATALREIKIFWLTCIISDLEEMDHIKNQLQPSPFSRCVITFQ 216 + LV+ LLENAT L E+KI +L C+ S+LE + ++ NQL PS CV FQ Sbjct: 415 VRLVKLLLENATILEEMKISFLECLSSNLEHLTNVMNQLGPSDQGNCVTMFQ 466