BLASTX nr result
ID: Astragalus22_contig00016189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00016189 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020228454.1| glutamine synthetase nodule isozyme [Cajanus... 91 2e-19 dbj|BAD06458.1| glutamine synthetase, partial [Camellia sinensis] 85 3e-19 gb|PKI34246.1| hypothetical protein CRG98_045345 [Punica granatum] 88 2e-18 gb|OWM90679.1| hypothetical protein CDL15_Pgr020984 [Punica gran... 88 2e-18 gb|AET22435.1| glutamine synthetase, partial [Camellia sinensis] 85 2e-18 ref|XP_023515062.1| glutamine synthetase nodule isozyme-like iso... 87 2e-18 ref|XP_023004588.1| glutamine synthetase nodule isozyme-like iso... 87 2e-18 ref|XP_022960252.1| glutamine synthetase nodule isozyme-like iso... 87 2e-18 gb|AAB71692.1| cytosolic glutamine synthetase, partial [Daucus c... 87 3e-18 gb|OMO99269.1| hypothetical protein COLO4_13418 [Corchorus olito... 86 6e-18 ref|XP_023004587.1| glutamine synthetase nodule isozyme-like iso... 87 7e-18 ref|XP_022960251.1| glutamine synthetase nodule isozyme-like iso... 87 7e-18 ref|XP_022743221.1| glutamine synthetase nodule isozyme-like iso... 87 7e-18 ref|XP_021912262.1| glutamine synthetase nodule isozyme-like [Ca... 87 7e-18 ref|XP_017244393.1| PREDICTED: glutamine synthetase cytosolic is... 87 7e-18 ref|XP_022743213.1| glutamine synthetase nodule isozyme-like iso... 87 7e-18 gb|ACU15915.1| unknown [Glycine max] 85 7e-18 gb|AAD31899.1|AF145481_1 cytosolic glutamine synthetase, partial... 86 9e-18 ref|XP_021891351.1| glutamine synthetase nodule isozyme-like [Ca... 84 9e-18 gb|PKA65189.1| Glutamine synthetase nodule isozyme [Apostasia sh... 86 9e-18 >ref|XP_020228454.1| glutamine synthetase nodule isozyme [Cajanus cajan] gb|KYP75961.1| Glutamine synthetase nodule isozyme [Cajanus cajan] Length = 356 Score = 90.9 bits (224), Expect = 2e-19 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG Sbjct: 126 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 162 >dbj|BAD06458.1| glutamine synthetase, partial [Camellia sinensis] Length = 101 Score = 84.7 bits (208), Expect = 3e-19 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVGV 116 YGIEQEYTLL+K+V WPLGWP+GGFPGPQGPYYCG+GV Sbjct: 41 YGIEQEYTLLQKQVKWPLGWPLGGFPGPQGPYYCGIGV 78 >gb|PKI34246.1| hypothetical protein CRG98_045345 [Punica granatum] Length = 356 Score = 88.2 bits (217), Expect = 2e-18 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCGVG Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGVG 162 >gb|OWM90679.1| hypothetical protein CDL15_Pgr020984 [Punica granatum] Length = 360 Score = 88.2 bits (217), Expect = 2e-18 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCGVG Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGVG 162 >gb|AET22435.1| glutamine synthetase, partial [Camellia sinensis] Length = 178 Score = 84.7 bits (208), Expect = 2e-18 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVGV 116 YGIEQEYTLL+K+V WPLGWP+GGFPGPQGPYYCG+GV Sbjct: 106 YGIEQEYTLLQKQVKWPLGWPLGGFPGPQGPYYCGIGV 143 >ref|XP_023515062.1| glutamine synthetase nodule isozyme-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 272 Score = 86.7 bits (213), Expect = 2e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >ref|XP_023004588.1| glutamine synthetase nodule isozyme-like isoform X2 [Cucurbita maxima] Length = 272 Score = 86.7 bits (213), Expect = 2e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >ref|XP_022960252.1| glutamine synthetase nodule isozyme-like isoform X2 [Cucurbita moschata] Length = 272 Score = 86.7 bits (213), Expect = 2e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >gb|AAB71692.1| cytosolic glutamine synthetase, partial [Daucus carota] Length = 284 Score = 86.7 bits (213), Expect = 3e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLLKK+VHWPLGWP GGFPGPQGPYYCG+G Sbjct: 54 YGIEQEYTLLKKDVHWPLGWPNGGFPGPQGPYYCGIG 90 >gb|OMO99269.1| hypothetical protein COLO4_13418 [Corchorus olitorius] Length = 266 Score = 85.5 bits (210), Expect = 6e-18 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVGV 116 YG+EQEYTLL+K+V WPLGWPVGGFPGPQGPYYCGVGV Sbjct: 36 YGLEQEYTLLQKDVKWPLGWPVGGFPGPQGPYYCGVGV 73 >ref|XP_023004587.1| glutamine synthetase nodule isozyme-like isoform X1 [Cucurbita maxima] Length = 356 Score = 86.7 bits (213), Expect = 7e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >ref|XP_022960251.1| glutamine synthetase nodule isozyme-like isoform X1 [Cucurbita moschata] ref|XP_023515061.1| glutamine synthetase nodule isozyme-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 356 Score = 86.7 bits (213), Expect = 7e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >ref|XP_022743221.1| glutamine synthetase nodule isozyme-like isoform X2 [Durio zibethinus] Length = 356 Score = 86.7 bits (213), Expect = 7e-18 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWP+GWP+GGFPGPQGPYYCGVG Sbjct: 126 YGIEQEYTLLQKDVHWPVGWPIGGFPGPQGPYYCGVG 162 >ref|XP_021912262.1| glutamine synthetase nodule isozyme-like [Carica papaya] Length = 356 Score = 86.7 bits (213), Expect = 7e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWPLGWPVGGFPGPQGPYYCG G Sbjct: 126 YGIEQEYTLLQKDVHWPLGWPVGGFPGPQGPYYCGTG 162 >ref|XP_017244393.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Daucus carota subsp. sativus] gb|KZM98474.1| hypothetical protein DCAR_014164 [Daucus carota subsp. sativus] Length = 356 Score = 86.7 bits (213), Expect = 7e-18 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLLKK+VHWPLGWP GGFPGPQGPYYCG+G Sbjct: 126 YGIEQEYTLLKKDVHWPLGWPNGGFPGPQGPYYCGIG 162 >ref|XP_022743213.1| glutamine synthetase nodule isozyme-like isoform X1 [Durio zibethinus] Length = 360 Score = 86.7 bits (213), Expect = 7e-18 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K+VHWP+GWP+GGFPGPQGPYYCGVG Sbjct: 130 YGIEQEYTLLQKDVHWPVGWPIGGFPGPQGPYYCGVG 166 >gb|ACU15915.1| unknown [Glycine max] Length = 234 Score = 84.7 bits (208), Expect = 7e-18 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+K++ WPLGWPVGGFPGPQGPYYCGVG Sbjct: 126 YGIEQEYTLLQKDIQWPLGWPVGGFPGPQGPYYCGVG 162 >gb|AAD31899.1|AF145481_1 cytosolic glutamine synthetase, partial [Mesembryanthemum crystallinum] Length = 349 Score = 86.3 bits (212), Expect = 9e-18 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVG 113 YGIEQEYTLL+KEV+WPLGWP+GGFPGPQGPYYCGVG Sbjct: 119 YGIEQEYTLLQKEVNWPLGWPIGGFPGPQGPYYCGVG 155 >ref|XP_021891351.1| glutamine synthetase nodule isozyme-like [Carica papaya] Length = 210 Score = 84.0 bits (206), Expect = 9e-18 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVGV 116 YGIEQEYTLL+K+V WPLGWP+GG+PGPQGPYYCGVGV Sbjct: 126 YGIEQEYTLLQKDVKWPLGWPLGGYPGPQGPYYCGVGV 163 >gb|PKA65189.1| Glutamine synthetase nodule isozyme [Apostasia shenzhenica] Length = 356 Score = 86.3 bits (212), Expect = 9e-18 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 3 YGIEQEYTLLKKEVHWPLGWPVGGFPGPQGPYYCGVGV 116 YGIEQEYTLL+K+V WPLGWPVGGFPGPQGPYYCGVGV Sbjct: 126 YGIEQEYTLLQKDVKWPLGWPVGGFPGPQGPYYCGVGV 163