BLASTX nr result
ID: Astragalus22_contig00016056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00016056 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108957.1| cytochrome c oxidase assembly factor 5 [Moru... 141 2e-40 ref|XP_021282797.1| cytochrome c oxidase assembly factor 5 [Herr... 140 4e-40 ref|XP_015891080.1| PREDICTED: cytochrome c oxidase assembly fac... 140 6e-40 ref|XP_006858712.1| cytochrome c oxidase assembly factor 5 [Ambo... 140 6e-40 ref|XP_004489024.1| PREDICTED: cytochrome c oxidase assembly fac... 140 6e-40 ref|XP_010069543.1| PREDICTED: cytochrome c oxidase assembly fac... 139 1e-39 ref|XP_007029447.1| PREDICTED: cytochrome c oxidase assembly fac... 138 2e-39 ref|XP_022742975.1| mitochondrial protein pet191 homolog [Durio ... 138 4e-39 ref|XP_018838938.1| PREDICTED: cytochrome c oxidase assembly fac... 138 4e-39 ref|XP_010553629.1| PREDICTED: cytochrome c oxidase assembly fac... 138 4e-39 ref|XP_011032997.1| PREDICTED: cytochrome c oxidase assembly fac... 137 5e-39 ref|XP_009365631.1| PREDICTED: cytochrome c oxidase assembly fac... 137 7e-39 ref|XP_010271113.1| PREDICTED: cytochrome c oxidase assembly fac... 137 1e-38 ref|XP_008377367.1| PREDICTED: cytochrome c oxidase assembly fac... 137 1e-38 ref|XP_002263356.1| PREDICTED: cytochrome c oxidase assembly fac... 136 1e-38 ref|XP_006446097.1| mitochondrial protein pet191 homolog isoform... 136 1e-38 ref|XP_002310953.2| hypothetical protein POPTR_0008s01080g [Popu... 136 1e-38 ref|XP_021970049.1| cytochrome c oxidase assembly factor 5-like ... 136 2e-38 ref|XP_021655785.1| mitochondrial protein pet191 homolog [Hevea ... 136 2e-38 ref|XP_008220734.1| PREDICTED: cytochrome c oxidase assembly fac... 135 3e-38 >ref|XP_010108957.1| cytochrome c oxidase assembly factor 5 [Morus notabilis] ref|XP_024029600.1| cytochrome c oxidase assembly factor 5 [Morus notabilis] gb|EXC20597.1| hypothetical protein L484_027152 [Morus notabilis] Length = 71 Score = 141 bits (356), Expect = 2e-40 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVENRSFRECAGEKSP+ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVENRSFRECAGEKSPTISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_021282797.1| cytochrome c oxidase assembly factor 5 [Herrania umbratica] Length = 71 Score = 140 bits (353), Expect = 4e-40 Identities = 67/71 (94%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RSFRECAGEKSPSISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_015891080.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Ziziphus jujuba] ref|XP_015891142.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Ziziphus jujuba] ref|XP_015891211.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Ziziphus jujuba] ref|XP_015891280.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Ziziphus jujuba] Length = 71 Score = 140 bits (352), Expect = 6e-40 Identities = 66/71 (92%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+C+KVE RSFRECAGEKSPSISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCIKVEKRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_006858712.1| cytochrome c oxidase assembly factor 5 [Amborella trichopoda] gb|ERN20179.1| hypothetical protein AMTR_s00066p00108160 [Amborella trichopoda] Length = 71 Score = 140 bits (352), Expect = 6e-40 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ESNCVKVENRS+RECAGEK PSI SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESNCVKVENRSYRECAGEKEPSIPSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_004489024.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Cicer arietinum] Length = 71 Score = 140 bits (352), Expect = 6e-40 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVENRS+REC+GEKSPSISSECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLAVELVKCLSESDCVKVENRSYRECSGEKSPSISSECVGLRETYFNCKRGQID 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010069543.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Eucalyptus grandis] Length = 71 Score = 139 bits (350), Expect = 1e-39 Identities = 66/71 (92%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RS+RECAGEKSPSISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSYRECAGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_007029447.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Theobroma cacao] gb|EOY09949.1| N-terminal [Theobroma cacao] Length = 71 Score = 138 bits (348), Expect = 2e-39 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RSFRECAGEKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_022742975.1| mitochondrial protein pet191 homolog [Durio zibethinus] Length = 71 Score = 138 bits (347), Expect = 4e-39 Identities = 65/71 (91%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RSFRECAGEKSPS+ SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPSVPSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_018838938.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Juglans regia] ref|XP_018838939.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Juglans regia] ref|XP_018838940.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Juglans regia] ref|XP_018838941.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Juglans regia] ref|XP_018838942.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Juglans regia] Length = 71 Score = 138 bits (347), Expect = 4e-39 Identities = 65/71 (91%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RS+RECAGEKSPSI+SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSYRECAGEKSPSIASECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010553629.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] ref|XP_010553630.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] ref|XP_010553631.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] ref|XP_010553632.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] ref|XP_010553633.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] ref|XP_010553635.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Tarenaya hassleriana] Length = 71 Score = 138 bits (347), Expect = 4e-39 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 M+KSCKGLAEELVKCL ES CVK E RSFRECAGEKSPSISSECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAEELVKCLSESICVKEEKRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_011032997.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] ref|XP_011032998.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] ref|XP_011032999.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] ref|XP_011033000.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] Length = 71 Score = 137 bits (346), Expect = 5e-39 Identities = 63/71 (88%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+C+K+ENRS++ECAGEKSPSI SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCIKIENRSYKECAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_009365631.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Pyrus x bretschneideri] ref|XP_009365632.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Pyrus x bretschneideri] Length = 71 Score = 137 bits (345), Expect = 7e-39 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 M+KSCKGLA ELVKCL E +CVKVE RSFRECAGEKSPSISSEC+GLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLATELVKCLSECDCVKVEKRSFRECAGEKSPSISSECIGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010271113.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Nelumbo nucifera] Length = 71 Score = 137 bits (344), Expect = 1e-38 Identities = 64/71 (90%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL E++CVKVE RS+RECAGEK+PSISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVEKRSYRECAGEKAPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_008377367.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Malus domestica] ref|XP_008377368.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Malus domestica] Length = 71 Score = 137 bits (344), Expect = 1e-38 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 M+KSCKGLA ELVKCL E +C+KVE RSFRECAGEKSPSISSEC+GLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLATELVKCLSECDCIKVEKRSFRECAGEKSPSISSECIGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002263356.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Vitis vinifera] emb|CBI25191.3| unnamed protein product, partial [Vitis vinifera] Length = 71 Score = 136 bits (343), Expect = 1e-38 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL E++CVKVE RSF+EC GEKSPSISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVEKRSFKECCGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_006446097.1| mitochondrial protein pet191 homolog isoform X1 [Citrus clementina] ref|XP_006470584.1| PREDICTED: mitochondrial protein pet191 homolog isoform X1 [Citrus sinensis] gb|ESR59337.1| hypothetical protein CICLE_v10017354mg [Citrus clementina] gb|KDO61300.1| hypothetical protein CISIN_1g034876mg [Citrus sinensis] Length = 71 Score = 136 bits (343), Expect = 1e-38 Identities = 65/71 (91%), Positives = 66/71 (92%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RSFRECAGEKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCIPSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002310953.2| hypothetical protein POPTR_0008s01080g [Populus trichocarpa] gb|PNT22008.1| hypothetical protein POPTR_008G010300v3 [Populus trichocarpa] Length = 71 Score = 136 bits (343), Expect = 1e-38 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+C+K+ENRS+++CAGEKSPSI SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCIKIENRSYKDCAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_021970049.1| cytochrome c oxidase assembly factor 5-like [Helianthus annuus] Length = 71 Score = 136 bits (342), Expect = 2e-38 Identities = 65/71 (91%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 M+KSCKGLA ELVKCL ES+CVKVENRSFRECA EKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVENRSFRECAKEKSPLISSECVGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_021655785.1| mitochondrial protein pet191 homolog [Hevea brasiliensis] Length = 71 Score = 136 bits (342), Expect = 2e-38 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 MSKSCKGLA ELVKCL ES+CVKVE RS+RECAGEKSPSI SECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSYRECAGEKSPSIPSECVGLRETYFNCKRGQLD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_008220734.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] ref|XP_008220735.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] ref|XP_008220736.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] ref|XP_007225036.2| cytochrome c oxidase assembly factor 5 [Prunus persica] ref|XP_020411421.1| cytochrome c oxidase assembly factor 5 [Prunus persica] ref|XP_020411422.1| cytochrome c oxidase assembly factor 5 [Prunus persica] ref|XP_020411423.1| cytochrome c oxidase assembly factor 5 [Prunus persica] ref|XP_020411424.1| cytochrome c oxidase assembly factor 5 [Prunus persica] ref|XP_021820988.1| cytochrome c oxidase assembly factor 5 [Prunus avium] gb|ONI32793.1| hypothetical protein PRUPE_1G386000 [Prunus persica] Length = 71 Score = 135 bits (341), Expect = 3e-38 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = +1 Query: 37 MSKSCKGLAEELVKCLGESNCVKVENRSFRECAGEKSPSISSECVGLRETYFNCKRGQVD 216 M+KSCKGLA ELVKCL E +CVKVE RS+RECAGEKSPSISSEC+GLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSECDCVKVEKRSYRECAGEKSPSISSECIGLRETYFNCKRGQVD 60 Query: 217 MRARIRGNKGY 249 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71