BLASTX nr result
ID: Astragalus22_contig00015815
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015815 (574 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013458311.1| hypothetical protein MTR_4g121923 [Medicago ... 53 8e-06 >ref|XP_013458311.1| hypothetical protein MTR_4g121923 [Medicago truncatula] gb|AFK39731.1| unknown [Medicago truncatula] gb|KEH32342.1| hypothetical protein MTR_4g121923 [Medicago truncatula] Length = 98 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/41 (60%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = +1 Query: 106 PNSQQIATPKRDLPSD---ASFNNSGTQNMRGLINNAGYTK 219 PNS +A + D D ASFNN+GTQNM+GLINN+GYTK Sbjct: 37 PNSNAVAPQRHDTSQDQFLASFNNTGTQNMKGLINNSGYTK 77