BLASTX nr result
ID: Astragalus22_contig00015699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015699 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAE20423.1| hypothetical protein AXG93_4905s1230 [Marchantia ... 94 2e-22 ref|XP_010275525.1| PREDICTED: thioredoxin H-type-like [Nelumbo ... 91 2e-21 gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] 89 1e-20 ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] 89 1e-20 ref|XP_011028925.1| PREDICTED: thioredoxin H1-like [Populus euph... 89 1e-20 ref|XP_001766436.1| predicted protein [Physcomitrella patens] >g... 89 1e-20 ref|XP_019229489.1| PREDICTED: thioredoxin H-type 2 [Nicotiana a... 89 1e-20 ref|XP_017430223.1| PREDICTED: thioredoxin H1 [Vigna angularis] ... 89 2e-20 ref|XP_015065645.1| PREDICTED: thioredoxin H-type 2 [Solanum pen... 88 2e-20 ref|XP_002510456.1| PREDICTED: thioredoxin H-type-like [Ricinus ... 88 2e-20 ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2 [Solanum lyc... 88 2e-20 ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum... 88 2e-20 ref|XP_010254672.1| PREDICTED: thioredoxin H-type-like [Nelumbo ... 88 3e-20 ref|XP_008377190.1| PREDICTED: thioredoxin H-type [Malus domestica] 88 3e-20 gb|OWM80882.1| hypothetical protein CDL15_Pgr006913 [Punica gran... 88 3e-20 ref|XP_019458146.1| PREDICTED: thioredoxin H-type-like [Lupinus ... 88 3e-20 gb|KOM49108.1| hypothetical protein LR48_Vigan07g281200 [Vigna a... 89 3e-20 ref|XP_007136039.1| hypothetical protein PHAVU_009G012800g [Phas... 88 3e-20 ref|XP_023873520.1| thioredoxin H-type-like [Quercus suber] >gi|... 87 6e-20 dbj|GAY42621.1| hypothetical protein CUMW_068340 [Citrus unshiu]... 87 6e-20 >gb|OAE20423.1| hypothetical protein AXG93_4905s1230 [Marchantia polymorpha subsp. ruderalis] Length = 140 Score = 94.0 bits (232), Expect = 2e-22 Identities = 41/70 (58%), Positives = 58/70 (82%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 +PIF EL++KH +++FLKVDVD+ IA++WEVRAMPTF+FIK+ K+V+KIVGAN EL+ Sbjct: 46 SPIFTELSKKHEDIVFLKVDVDEFQEIASEWEVRAMPTFLFIKDGKIVEKIVGANKDELE 105 Query: 125 GKIAEYATDT 96 K+ +A +T Sbjct: 106 SKVRFFAAET 115 >ref|XP_010275525.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera] Length = 115 Score = 90.5 bits (223), Expect = 2e-21 Identities = 45/65 (69%), Positives = 51/65 (78%) Frame = -1 Query: 302 PIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQG 123 PI AELA+K NVIFLKVDVD+L +AT WEV AMPTFIF+KE K+VDKIVGA ELQ Sbjct: 47 PILAELAKKLPNVIFLKVDVDELKSVATDWEVEAMPTFIFLKEGKIVDKIVGARKEELQQ 106 Query: 122 KIAEY 108 KI + Sbjct: 107 KITTH 111 >gb|OAY74795.1| Thioredoxin H1 [Ananas comosus] Length = 112 Score = 88.6 bits (218), Expect = 1e-20 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP+FAE A+K+ V+FLKVDVD+L G+A +WEV AMPTF+F+KE K VDK+VGA ELQ Sbjct: 46 APVFAEFAKKYPGVVFLKVDVDELKGVAREWEVEAMPTFVFLKEGKAVDKLVGAVKDELQ 105 Query: 125 GKI 117 KI Sbjct: 106 KKI 108 >ref|XP_020091655.1| thioredoxin H1-like [Ananas comosus] Length = 114 Score = 88.6 bits (218), Expect = 1e-20 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP+FAE A+K+ V+FLKVDVD+L G+A +WEV AMPTF+F+KE K VDK+VGA ELQ Sbjct: 46 APVFAEFAKKYPGVVFLKVDVDELKGVAREWEVEAMPTFVFLKEGKAVDKLVGAVKDELQ 105 Query: 125 GKI 117 KI Sbjct: 106 KKI 108 >ref|XP_011028925.1| PREDICTED: thioredoxin H1-like [Populus euphratica] Length = 116 Score = 88.6 bits (218), Expect = 1e-20 Identities = 42/71 (59%), Positives = 56/71 (78%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 APIFA+LA+K +NV FLKVDVD+LN +A +WEV AMPTFIF+K+ KLVDKIVGA+ L Sbjct: 46 APIFADLAKKFTNVTFLKVDVDELNAVAAEWEVEAMPTFIFLKDGKLVDKIVGADKDGLP 105 Query: 125 GKIAEYATDTS 93 + +++ T+ Sbjct: 106 ALVEKHSVYTA 116 >ref|XP_001766436.1| predicted protein [Physcomitrella patens] gb|PNR59751.1| hypothetical protein PHYPA_002543 [Physcomitrella patens] Length = 117 Score = 88.6 bits (218), Expect = 1e-20 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 APIF EL++K+ N+IFLKVDVD++ + ++WEVRAMPTFIFIK+ K + K+VGAN EL+ Sbjct: 45 APIFVELSKKYENIIFLKVDVDEVKDVTSQWEVRAMPTFIFIKDGKSIHKVVGANKDELE 104 Query: 125 GKIAEYAT 102 K ++A+ Sbjct: 105 KKCQQFAS 112 >ref|XP_019229489.1| PREDICTED: thioredoxin H-type 2 [Nicotiana attenuata] gb|OIT06355.1| thioredoxin h-type 2 [Nicotiana attenuata] Length = 118 Score = 88.6 bits (218), Expect = 1e-20 Identities = 43/72 (59%), Positives = 54/72 (75%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP FAELA+K V FLKVDVD+L +AT W V AMPTF+F+KE K+VDK+VGA ELQ Sbjct: 46 APFFAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQ 105 Query: 125 GKIAEYATDTSS 90 IA++ + TS+ Sbjct: 106 QTIAKHISSTST 117 >ref|XP_017430223.1| PREDICTED: thioredoxin H1 [Vigna angularis] dbj|BAT82818.1| hypothetical protein VIGAN_03288700 [Vigna angularis var. angularis] Length = 124 Score = 88.6 bits (218), Expect = 2e-20 Identities = 40/70 (57%), Positives = 56/70 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 API AE+A+K +VIFLKVDVD+L+ ++ +W + AMPTF+F+KE +LVDK+VGAN +LQ Sbjct: 47 APILAEIAKKTPHVIFLKVDVDELSSVSEEWSIEAMPTFLFLKEGELVDKVVGANKDQLQ 106 Query: 125 GKIAEYATDT 96 IA++A T Sbjct: 107 ATIAKHAAST 116 >ref|XP_015065645.1| PREDICTED: thioredoxin H-type 2 [Solanum pennellii] Length = 118 Score = 88.2 bits (217), Expect = 2e-20 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP AELA+K V FLKVDVD+L +AT W V AMPTF+FIKE K+VDK+VGA ELQ Sbjct: 46 APFLAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQ 105 Query: 125 GKIAEYATDTSS 90 IA++ + TSS Sbjct: 106 QTIAKHISSTSS 117 >ref|XP_002510456.1| PREDICTED: thioredoxin H-type-like [Ricinus communis] gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis] Length = 118 Score = 88.2 bits (217), Expect = 2e-20 Identities = 43/68 (63%), Positives = 52/68 (76%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 API AE+A+K NV FLKVDVD+L +A W V AMPTF+F+KE K+V K+VGAN ELQ Sbjct: 46 APILAEMAKKMPNVTFLKVDVDELKSVAEDWAVEAMPTFMFLKEGKIVHKVVGANKEELQ 105 Query: 125 GKIAEYAT 102 IA+YAT Sbjct: 106 MTIAKYAT 113 >ref|XP_004232447.1| PREDICTED: thioredoxin H-type 2 [Solanum lycopersicum] Length = 118 Score = 88.2 bits (217), Expect = 2e-20 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP AELA+K V FLKVDVD+L +AT W V AMPTF+FIKE K+VDK+VGA ELQ Sbjct: 46 APFLAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQ 105 Query: 125 GKIAEYATDTSS 90 IA++ + TSS Sbjct: 106 QTIAKHISSTSS 117 >ref|NP_001275313.1| thioredoxin H-type 2-like [Solanum tuberosum] gb|AFX66981.1| thioredoxin H-type 2 [Solanum tuberosum] Length = 118 Score = 88.2 bits (217), Expect = 2e-20 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP AELA+K V FLKVDVD+L +AT W V AMPTF+FIKE K+VDK+VGA ELQ Sbjct: 46 APFLAELAKKIPTVTFLKVDVDELKSVATDWAVEAMPTFMFIKEGKIVDKVVGAKKDELQ 105 Query: 125 GKIAEYATDTSS 90 IA++ + TSS Sbjct: 106 QTIAKHISSTSS 117 >ref|XP_010254672.1| PREDICTED: thioredoxin H-type-like [Nelumbo nucifera] Length = 114 Score = 87.8 bits (216), Expect = 3e-20 Identities = 44/66 (66%), Positives = 51/66 (77%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 API AELA+K NVIFLKVDVD+L +AT W V AMPTF+F+KE K+VDKIVGA ELQ Sbjct: 46 APILAELAKKLPNVIFLKVDVDELKTVATDWAVEAMPTFMFLKEGKIVDKIVGARKEELQ 105 Query: 125 GKIAEY 108 KI + Sbjct: 106 QKITAH 111 >ref|XP_008377190.1| PREDICTED: thioredoxin H-type [Malus domestica] Length = 127 Score = 88.2 bits (217), Expect = 3e-20 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 APIFAELA K+ V FLKVDVD+L ++ +W V AMPTF+F+KE K+VDK+VGA ELQ Sbjct: 45 APIFAELARKNPEVTFLKVDVDELKTVSEEWGVEAMPTFLFLKEGKVVDKVVGAKKDELQ 104 Query: 125 GKIAEYAT 102 K+A++AT Sbjct: 105 LKVAKHAT 112 >gb|OWM80882.1| hypothetical protein CDL15_Pgr006913 [Punica granatum] gb|PKI35190.1| hypothetical protein CRG98_044465 [Punica granatum] Length = 118 Score = 87.8 bits (216), Expect = 3e-20 Identities = 40/72 (55%), Positives = 54/72 (75%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP+ A+ A + NVIFLKVDVD+L +A W V AMPTF+F+KE K++DK+VGA ELQ Sbjct: 46 APVLADFARRMPNVIFLKVDVDELRSVAEDWAVEAMPTFMFLKEGKIIDKVVGARKEELQ 105 Query: 125 GKIAEYATDTSS 90 KI +AT+T++ Sbjct: 106 MKITTHATETAA 117 >ref|XP_019458146.1| PREDICTED: thioredoxin H-type-like [Lupinus angustifolius] gb|OIW03514.1| hypothetical protein TanjilG_31027 [Lupinus angustifolius] Length = 119 Score = 87.8 bits (216), Expect = 3e-20 Identities = 42/72 (58%), Positives = 56/72 (77%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 APIFAE+A+K V FLKVDVD+L +A +W V AMPTF+F+KE K+VDK+VGAN +L Sbjct: 46 APIFAEIAKKTPEVTFLKVDVDELKTVAEEWGVEAMPTFLFVKEGKVVDKVVGANKEDLH 105 Query: 125 GKIAEYATDTSS 90 KIA+++T S+ Sbjct: 106 LKIAKHSTAASA 117 >gb|KOM49108.1| hypothetical protein LR48_Vigan07g281200 [Vigna angularis] Length = 148 Score = 88.6 bits (218), Expect = 3e-20 Identities = 40/70 (57%), Positives = 56/70 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 API AE+A+K +VIFLKVDVD+L+ ++ +W + AMPTF+F+KE +LVDK+VGAN +LQ Sbjct: 71 APILAEIAKKTPHVIFLKVDVDELSSVSEEWSIEAMPTFLFLKEGELVDKVVGANKDQLQ 130 Query: 125 GKIAEYATDT 96 IA++A T Sbjct: 131 ATIAKHAAST 140 >ref|XP_007136039.1| hypothetical protein PHAVU_009G012800g [Phaseolus vulgaris] gb|ESW08033.1| hypothetical protein PHAVU_009G012800g [Phaseolus vulgaris] Length = 122 Score = 87.8 bits (216), Expect = 3e-20 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 API AE+A+K +V FLKVDVD+L ++T+W+V AMPTF+F+KE KLVDK+VGA ELQ Sbjct: 46 APILAEIAKKLPHVTFLKVDVDELESVSTEWKVEAMPTFLFLKEGKLVDKVVGAKKDELQ 105 Query: 125 GKIAEYAT 102 IA++AT Sbjct: 106 LAIAKHAT 113 >ref|XP_023873520.1| thioredoxin H-type-like [Quercus suber] gb|POE84499.1| thioredoxin h-type [Quercus suber] Length = 116 Score = 87.0 bits (214), Expect = 6e-20 Identities = 42/68 (61%), Positives = 53/68 (77%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP+ AELA+K NV+FLKVDVD+L +A +W V AMPTF+F+KE KLVDK+VGA ELQ Sbjct: 46 APVLAELAKKTPNVLFLKVDVDELKTVAEEWAVEAMPTFLFLKEGKLVDKVVGAKKEELQ 105 Query: 125 GKIAEYAT 102 I ++AT Sbjct: 106 LTIEKHAT 113 >dbj|GAY42621.1| hypothetical protein CUMW_068340 [Citrus unshiu] dbj|GAY42622.1| hypothetical protein CUMW_068340 [Citrus unshiu] Length = 119 Score = 87.0 bits (214), Expect = 6e-20 Identities = 42/72 (58%), Positives = 53/72 (73%) Frame = -1 Query: 305 APIFAELAEKHSNVIFLKVDVDDLNGIATKWEVRAMPTFIFIKESKLVDKIVGANIPELQ 126 AP AELA+K NV+FLKVDVD+L +AT W V AMPTF+F+KE K+VDK+VGA ELQ Sbjct: 48 APFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQ 107 Query: 125 GKIAEYATDTSS 90 IA++ S+ Sbjct: 108 QTIAKHLATASA 119