BLASTX nr result
ID: Astragalus22_contig00015673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015673 (329 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI67739.1| hypothetical protein CRG98_011952, partial [Punic... 52 6e-06 >gb|PKI67739.1| hypothetical protein CRG98_011952, partial [Punica granatum] Length = 148 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 327 TYDGAEEAIQGNSSRVESVKERYKEHESGSDYNRKGN*EP 208 TYDG EEA+ GNS ESVK++YKEHE +DY + G+ EP Sbjct: 99 TYDGTEEAVMGNSDS-ESVKKKYKEHEENADYPKTGDDEP 137