BLASTX nr result
ID: Astragalus22_contig00015480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015480 (727 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU36526.1| hypothetical protein TSUD_316520, partial [Trifo... 97 7e-22 ref|XP_013461729.1| carboxy-terminal domain cyclin [Medicago tru... 100 4e-21 gb|PNY17066.1| cyclin-a3-1-like protein [Trifolium pratense] 99 1e-20 ref|XP_004501544.1| PREDICTED: G2/mitotic-specific cyclin C13-1 ... 99 1e-20 dbj|GAU36522.1| hypothetical protein TSUD_316480 [Trifolium subt... 96 2e-20 gb|KHN04461.1| Putative cyclin-A3-1 [Glycine soja] 98 3e-20 dbj|GAU36529.1| hypothetical protein TSUD_316550 [Trifolium subt... 93 5e-20 ref|XP_004501543.1| PREDICTED: putative cyclin-A3-1 [Cicer ariet... 96 1e-19 dbj|BAT92152.1| hypothetical protein VIGAN_07082800 [Vigna angul... 92 1e-19 ref|XP_006578041.1| PREDICTED: putative cyclin-A3-1 [Glycine max] 95 4e-19 gb|KRH61372.1| hypothetical protein GLYMA_04G043600 [Glycine max] 95 6e-19 gb|KRH61373.1| hypothetical protein GLYMA_04G043600 [Glycine max... 95 6e-19 gb|PNX93569.1| cyclin-a3-1-like protein [Trifolium pratense] 94 1e-18 gb|KRH61370.1| hypothetical protein GLYMA_04G043500 [Glycine max] 93 2e-18 gb|KHN04463.1| Putative cyclin-A3-1 [Glycine soja] 93 2e-18 ref|XP_003523987.1| PREDICTED: putative cyclin-A3-1 [Glycine max... 93 2e-18 dbj|GAU36524.1| hypothetical protein TSUD_316500 [Trifolium subt... 90 2e-18 gb|PNY16378.1| cyclin-a3-1-like protein, partial [Trifolium prat... 94 3e-18 ref|XP_014499779.1| putative cyclin-A3-1 [Vigna radiata var. rad... 92 3e-18 ref|XP_017424289.1| PREDICTED: putative cyclin-A3-1 [Vigna angul... 92 3e-18 >dbj|GAU36526.1| hypothetical protein TSUD_316520, partial [Trifolium subterraneum] Length = 128 Score = 97.1 bits (240), Expect = 7e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S ELKECVLILHDLYLSRRA+SF AVRDKYKQ KFK+VANLPSPPE+P YF+E+ Sbjct: 74 SAELKECVLILHDLYLSRRASSFKAVRDKYKQNKFKYVANLPSPPEIPVNYFDEE 128 >ref|XP_013461729.1| carboxy-terminal domain cyclin [Medicago truncatula] gb|KEH35764.1| carboxy-terminal domain cyclin [Medicago truncatula] Length = 340 Score = 100 bits (248), Expect = 4e-21 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S EL+ECV+ILHDLYLSRRAASF AVR+KYKQQKFK+VANLPS PE+P YYFEED Sbjct: 286 SAELEECVMILHDLYLSRRAASFKAVREKYKQQKFKYVANLPSSPEIPNYYFEED 340 >gb|PNY17066.1| cyclin-a3-1-like protein [Trifolium pratense] Length = 353 Score = 99.0 bits (245), Expect = 1e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +2 Query: 8 ELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 ELKECVLILHDLYLSRRAASF AVRDKYKQ+KFK+VANLPSPPE+P YFEE+ Sbjct: 301 ELKECVLILHDLYLSRRAASFKAVRDKYKQKKFKYVANLPSPPEIPHNYFEEE 353 >ref|XP_004501544.1| PREDICTED: G2/mitotic-specific cyclin C13-1 [Cicer arietinum] Length = 356 Score = 99.0 bits (245), Expect = 1e-20 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 S ELKECVLILHD+YLSRRAASF+AVRDKYKQ KFK VANLPSPPEVP +YFEE Sbjct: 302 STELKECVLILHDMYLSRRAASFNAVRDKYKQTKFKCVANLPSPPEVPNHYFEE 355 >dbj|GAU36522.1| hypothetical protein TSUD_316480 [Trifolium subterraneum] Length = 221 Score = 95.9 bits (237), Expect = 2e-20 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S EL+ECVLILHDLYLSRRAAS AVR+KYKQ KFK VANLPSPPEVP YYFEE+ Sbjct: 167 SNELEECVLILHDLYLSRRAASLKAVREKYKQHKFKSVANLPSPPEVPNYYFEEE 221 >gb|KHN04461.1| Putative cyclin-A3-1 [Glycine soja] Length = 346 Score = 97.8 bits (242), Expect = 3e-20 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +2 Query: 8 ELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 +LKECVLILHDLYLSR+AASF AVRDKYKQ KFK+VANLPSPP VP YYFEE Sbjct: 294 DLKECVLILHDLYLSRKAASFKAVRDKYKQHKFKYVANLPSPPHVPSYYFEE 345 >dbj|GAU36529.1| hypothetical protein TSUD_316550 [Trifolium subterraneum] Length = 150 Score = 92.8 bits (229), Expect = 5e-20 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S +L+ECV +LHDLYLSRR ASF AVRDKYKQQKFK+VA+LPSPPEVP YFEE+ Sbjct: 96 SADLEECVTMLHDLYLSRREASFKAVRDKYKQQKFKYVADLPSPPEVPSNYFEEE 150 >ref|XP_004501543.1| PREDICTED: putative cyclin-A3-1 [Cicer arietinum] Length = 336 Score = 96.3 bits (238), Expect = 1e-19 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S EL+ECVLILHDLYLSRRAASF AVRDKYKQ KFK VANLPSPPEV K+YFEE+ Sbjct: 282 SAELEECVLILHDLYLSRRAASFKAVRDKYKQPKFKCVANLPSPPEVLKHYFEEE 336 >dbj|BAT92152.1| hypothetical protein VIGAN_07082800 [Vigna angularis var. angularis] Length = 166 Score = 92.4 bits (228), Expect = 1e-19 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 S ELKECVLILHDLYL R+AASF AVRDKYKQQKFK VANLPSPP VP YFE+ Sbjct: 92 SAELKECVLILHDLYLLRKAASFKAVRDKYKQQKFKCVANLPSPPYVPNCYFED 145 >ref|XP_006578041.1| PREDICTED: putative cyclin-A3-1 [Glycine max] Length = 346 Score = 94.7 bits (234), Expect = 4e-19 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +2 Query: 8 ELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 +LKECVLILHDLYLSR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFEE Sbjct: 294 DLKECVLILHDLYLSRKAVSFKAVREKYKQHKFKYVANLPSPPHVPSYYFEE 345 >gb|KRH61372.1| hypothetical protein GLYMA_04G043600 [Glycine max] Length = 370 Score = 94.7 bits (234), Expect = 6e-19 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +2 Query: 8 ELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 +LKECVLILHDLYLSR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFEE Sbjct: 318 DLKECVLILHDLYLSRKAVSFKAVREKYKQHKFKYVANLPSPPHVPSYYFEE 369 >gb|KRH61373.1| hypothetical protein GLYMA_04G043600 [Glycine max] gb|KRH61374.1| hypothetical protein GLYMA_04G043600 [Glycine max] Length = 375 Score = 94.7 bits (234), Expect = 6e-19 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +2 Query: 8 ELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 +LKECVLILHDLYLSR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFEE Sbjct: 323 DLKECVLILHDLYLSRKAVSFKAVREKYKQHKFKYVANLPSPPHVPSYYFEE 374 >gb|PNX93569.1| cyclin-a3-1-like protein [Trifolium pratense] Length = 358 Score = 94.0 bits (232), Expect = 1e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S EL+ECVLILHDLYLSRRAAS AVR+KYKQ KFK VANLPSPPEVP +YFEE+ Sbjct: 304 SNELEECVLILHDLYLSRRAASLKAVREKYKQHKFKSVANLPSPPEVPNHYFEEE 358 >gb|KRH61370.1| hypothetical protein GLYMA_04G043500 [Glycine max] Length = 348 Score = 92.8 bits (229), Expect = 2e-18 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +2 Query: 5 IELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 IELKECVLILHDLY SR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFE+ Sbjct: 295 IELKECVLILHDLYFSRKAESFKAVREKYKQPKFKYVANLPSPPFVPSYYFED 347 >gb|KHN04463.1| Putative cyclin-A3-1 [Glycine soja] Length = 349 Score = 92.8 bits (229), Expect = 2e-18 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +2 Query: 5 IELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 IELKECVLILHDLY SR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFE+ Sbjct: 296 IELKECVLILHDLYFSRKAESFKAVREKYKQPKFKYVANLPSPPFVPSYYFED 348 >ref|XP_003523987.1| PREDICTED: putative cyclin-A3-1 [Glycine max] gb|KRH61371.1| hypothetical protein GLYMA_04G043500 [Glycine max] Length = 349 Score = 92.8 bits (229), Expect = 2e-18 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +2 Query: 5 IELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 IELKECVLILHDLY SR+A SF AVR+KYKQ KFK+VANLPSPP VP YYFE+ Sbjct: 296 IELKECVLILHDLYFSRKAESFKAVREKYKQPKFKYVANLPSPPFVPSYYFED 348 >dbj|GAU36524.1| hypothetical protein TSUD_316500 [Trifolium subterraneum] Length = 194 Score = 89.7 bits (221), Expect = 2e-18 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S EL+ECVLILHDLYLSRRAAS AV+ KYKQ KFK VANLP PPEVP +YFEE+ Sbjct: 140 SDELEECVLILHDLYLSRRAASLKAVKQKYKQDKFKSVANLPVPPEVPNHYFEEE 194 >gb|PNY16378.1| cyclin-a3-1-like protein, partial [Trifolium pratense] Length = 475 Score = 93.6 bits (231), Expect = 3e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEED 166 S +L+ECV +LHD+YLSRRAASF AVRDKYKQ KFK VANLPSPPEVP +YFEE+ Sbjct: 421 SADLEECVTMLHDMYLSRRAASFKAVRDKYKQNKFKCVANLPSPPEVPNHYFEEE 475 Score = 81.6 bits (200), Expect = 4e-14 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFE 160 S +L+ECV +LHDLYLSRRAASF AVRDKYKQ KFK VANLPSPPE FE Sbjct: 314 SADLEECVTMLHDLYLSRRAASFKAVRDKYKQNKFKCVANLPSPPENSNLQFE 366 >ref|XP_014499779.1| putative cyclin-A3-1 [Vigna radiata var. radiata] Length = 348 Score = 92.4 bits (228), Expect = 3e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFE 160 S+ELKECV+ILHDLY SR+AASF AVR+KYKQ KFKFVA LPSPP +P +YFE Sbjct: 294 SVELKECVIILHDLYFSRKAASFKAVREKYKQHKFKFVARLPSPPHIPSHYFE 346 >ref|XP_017424289.1| PREDICTED: putative cyclin-A3-1 [Vigna angularis] gb|KOM44016.1| hypothetical protein LR48_Vigan05g162100 [Vigna angularis] Length = 349 Score = 92.4 bits (228), Expect = 3e-18 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = +2 Query: 2 SIELKECVLILHDLYLSRRAASFHAVRDKYKQQKFKFVANLPSPPEVPKYYFEE 163 S ELKECVLILHDLYL R+AASF AVRDKYKQQKFK VANLPSPP VP YFE+ Sbjct: 275 SAELKECVLILHDLYLLRKAASFKAVRDKYKQQKFKCVANLPSPPYVPNCYFED 328