BLASTX nr result
ID: Astragalus22_contig00015029
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015029 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019239992.1| PREDICTED: 60S ribosomal protein L37a-like [... 65 5e-11 gb|PNT49620.1| hypothetical protein POPTR_002G140100v3 [Populus ... 64 7e-11 gb|PKI36974.1| hypothetical protein CRG98_042675 [Punica granatum] 64 7e-11 gb|KZV57946.1| hypothetical protein F511_12102 [Dorcoceras hygro... 64 7e-11 gb|KRX77736.1| 60S ribosomal protein L37a [Trichinella patagonie... 64 7e-11 gb|ACU13460.1| unknown [Glycine max] >gi|947109217|gb|KRH57543.1... 64 7e-11 gb|KRH57542.1| hypothetical protein GLYMA_05G067400 [Glycine max] 64 8e-11 gb|EYU42328.1| hypothetical protein MIMGU_mgv1a0171311mg, partia... 64 9e-11 gb|AFK48860.1| unknown [Medicago truncatula] 64 1e-10 gb|KDO57018.1| hypothetical protein CISIN_1g044880mg, partial [C... 64 1e-10 gb|EYU42327.1| hypothetical protein MIMGU_mgv1a0171311mg, partia... 64 1e-10 ref|XP_024030673.1| 60S ribosomal protein L37a [Morus notabilis] 64 1e-10 gb|AUW34377.1| 60S ribosomal protein L37a [Lilium longiflorum] 64 1e-10 gb|PKI53527.1| hypothetical protein CRG98_026072 [Punica granatum] 64 1e-10 dbj|GAV87271.1| Ribosomal_L37ae domain-containing protein, parti... 64 1e-10 ref|XP_018819198.1| PREDICTED: 60S ribosomal protein L37a-1-like... 64 1e-10 ref|XP_018854860.1| PREDICTED: 60S ribosomal protein L37a-1 [Jug... 64 1e-10 ref|XP_016670633.1| PREDICTED: 60S ribosomal protein L37a-like [... 64 1e-10 ref|XP_016445344.1| PREDICTED: 60S ribosomal protein L37a-like [... 64 1e-10 ref|XP_015896738.1| PREDICTED: 60S ribosomal protein L37a [Zizip... 64 1e-10 >ref|XP_019239992.1| PREDICTED: 60S ribosomal protein L37a-like [Nicotiana attenuata] gb|OIT20576.1| 60s ribosomal protein l37a [Nicotiana attenuata] Length = 92 Score = 64.7 bits (156), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 166 FGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 +GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 60 YGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >gb|PNT49620.1| hypothetical protein POPTR_002G140100v3 [Populus trichocarpa] gb|PNT49623.1| hypothetical protein POPTR_002G140100v3 [Populus trichocarpa] gb|PNT49624.1| hypothetical protein POPTR_002G140100v3 [Populus trichocarpa] Length = 64 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >gb|PKI36974.1| hypothetical protein CRG98_042675 [Punica granatum] Length = 64 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >gb|KZV57946.1| hypothetical protein F511_12102 [Dorcoceras hygrometricum] Length = 64 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >gb|KRX77736.1| 60S ribosomal protein L37a [Trichinella patagoniensis] Length = 64 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >gb|ACU13460.1| unknown [Glycine max] gb|KRH57543.1| hypothetical protein GLYMA_05G067400 [Glycine max] gb|PNX55770.1| 60S ribosomal protein l37a-like [Trifolium pratense] gb|PNX57380.1| 60S ribosomal protein l37a-like [Trifolium pratense] Length = 64 Score = 63.5 bits (153), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >gb|KRH57542.1| hypothetical protein GLYMA_05G067400 [Glycine max] Length = 72 Score = 63.5 bits (153), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 41 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 72 >gb|EYU42328.1| hypothetical protein MIMGU_mgv1a0171311mg, partial [Erythranthe guttata] Length = 77 Score = 63.5 bits (153), Expect = 9e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 46 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 77 >gb|AFK48860.1| unknown [Medicago truncatula] Length = 79 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 48 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 79 >gb|KDO57018.1| hypothetical protein CISIN_1g044880mg, partial [Citrus sinensis] Length = 91 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 60 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >gb|EYU42327.1| hypothetical protein MIMGU_mgv1a0171311mg, partial [Erythranthe guttata] Length = 91 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 60 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >ref|XP_024030673.1| 60S ribosomal protein L37a [Morus notabilis] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >gb|AUW34377.1| 60S ribosomal protein L37a [Lilium longiflorum] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >gb|PKI53527.1| hypothetical protein CRG98_026072 [Punica granatum] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >dbj|GAV87271.1| Ribosomal_L37ae domain-containing protein, partial [Cephalotus follicularis] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_018819198.1| PREDICTED: 60S ribosomal protein L37a-1-like [Juglans regia] ref|XP_018837577.1| PREDICTED: 60S ribosomal protein L37a-1-like [Juglans regia] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_018854860.1| PREDICTED: 60S ribosomal protein L37a-1 [Juglans regia] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_016670633.1| PREDICTED: 60S ribosomal protein L37a-like [Gossypium hirsutum] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_016445344.1| PREDICTED: 60S ribosomal protein L37a-like [Nicotiana tabacum] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_015896738.1| PREDICTED: 60S ribosomal protein L37a [Ziziphus jujuba] ref|XP_015869321.1| PREDICTED: 60S ribosomal protein L37a [Ziziphus jujuba] Length = 92 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 169 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 264 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 61 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92