BLASTX nr result
ID: Astragalus22_contig00015014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00015014 (734 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017437407.1| PREDICTED: plant UBX domain-containing prote... 58 2e-09 ref|XP_006288273.1| plant UBX domain-containing protein 4 [Capse... 60 3e-09 gb|KHN40854.1| UBA and UBX domain-containing protein [Glycine soja] 58 3e-09 ref|XP_003546168.1| PREDICTED: plant UBX domain-containing prote... 58 3e-09 gb|ACU19568.1| unknown [Glycine max] 58 3e-09 ref|XP_014518441.1| plant UBX domain-containing protein 4 [Vigna... 57 3e-09 ref|XP_017437408.1| PREDICTED: plant UBX domain-containing prote... 57 3e-09 ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Popu... 58 4e-09 ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing pro... 58 4e-09 ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Popu... 58 4e-09 ref|XP_021635644.1| plant UBX domain-containing protein 4-like [... 57 4e-09 ref|XP_020221583.1| plant UBX domain-containing protein 4-like [... 57 4e-09 ref|XP_019429919.1| PREDICTED: plant UBX domain-containing prote... 58 5e-09 ref|XP_020226949.1| plant UBX domain-containing protein 4-like [... 57 5e-09 ref|XP_016195483.1| plant UBX domain-containing protein 4 [Arach... 57 5e-09 ref|XP_015940884.1| plant UBX domain-containing protein 4 [Arach... 57 5e-09 ref|XP_017436949.1| PREDICTED: plant UBX domain-containing prote... 57 5e-09 ref|XP_014518440.1| plant UBX domain-containing protein 4-like [... 57 5e-09 gb|KOM53285.1| hypothetical protein LR48_Vigan09g194400 [Vigna a... 57 5e-09 ref|XP_021599767.1| plant UBX domain-containing protein 4-like i... 56 6e-09 >ref|XP_017437407.1| PREDICTED: plant UBX domain-containing protein 4-like isoform X1 [Vigna angularis] Length = 308 Score = 58.2 bits (139), Expect(2) = 2e-09 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPEKLL*IFVMV 219 QP A H+IVFWSNGFTV+DGPLR LDDPE + VM+ Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPENASFLEVML 149 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 55 QDPSKGNDVDAIFNQARQ 72 >ref|XP_006288273.1| plant UBX domain-containing protein 4 [Capsella rubella] gb|EOA21171.1| hypothetical protein CARUB_v10001519mg [Capsella rubella] Length = 311 Score = 60.1 bits (144), Expect(2) = 3e-09 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 338 HQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 HQP H+IVFWSNGFT+DDGPLR LDDPE Sbjct: 106 HQPEPVVHNIVFWSNGFTIDDGPLRKLDDPE 136 Score = 30.0 bits (66), Expect(2) = 3e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK +DVD IFN+A+Q Sbjct: 54 QDPSKKDDVDEIFNQARQ 71 >gb|KHN40854.1| UBA and UBX domain-containing protein [Glycine soja] Length = 301 Score = 58.2 bits (139), Expect(2) = 3e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 32.0 bits (71), Expect(2) = 3e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDEIFNQARQ 69 >ref|XP_003546168.1| PREDICTED: plant UBX domain-containing protein 4 [Glycine max] gb|KRH11494.1| hypothetical protein GLYMA_15G112000 [Glycine max] Length = 301 Score = 58.2 bits (139), Expect(2) = 3e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 32.0 bits (71), Expect(2) = 3e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDEIFNQARQ 69 >gb|ACU19568.1| unknown [Glycine max] Length = 301 Score = 58.2 bits (139), Expect(2) = 3e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 105 NNQQPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 137 Score = 32.0 bits (71), Expect(2) = 3e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDEIFNQARQ 69 >ref|XP_014518441.1| plant UBX domain-containing protein 4 [Vigna radiata var. radiata] Length = 297 Score = 57.4 bits (137), Expect(2) = 3e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPE 140 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 55 QDPSKGNDVDAIFNQARQ 72 >ref|XP_017437408.1| PREDICTED: plant UBX domain-containing protein 4-like isoform X2 [Vigna angularis] gb|KOM53286.1| hypothetical protein LR48_Vigan09g194500 [Vigna angularis] dbj|BAT87504.1| hypothetical protein VIGAN_05088200 [Vigna angularis var. angularis] Length = 297 Score = 57.4 bits (137), Expect(2) = 3e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWSNGFTVNDGPLRRLDDPE 140 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 55 QDPSKGNDVDAIFNQARQ 72 >ref|XP_006383854.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gb|PNT38919.1| hypothetical protein POPTR_004G004200v3 [Populus trichocarpa] Length = 309 Score = 58.2 bits (139), Expect(2) = 4e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+P+K NDVD IFN+A+Q Sbjct: 56 QDPTKGNDVDAIFNQARQ 73 >ref|XP_011046995.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Populus euphratica] Length = 305 Score = 58.2 bits (139), Expect(2) = 4e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+P+K NDVD IFN+A+Q Sbjct: 56 QDPTKGNDVDAIFNQARQ 73 >ref|XP_006383853.1| hypothetical protein POPTR_0004s00590g [Populus trichocarpa] gb|ABK96017.1| unknown [Populus trichocarpa] gb|PNT38920.1| hypothetical protein POPTR_004G004200v3 [Populus trichocarpa] Length = 305 Score = 58.2 bits (139), Expect(2) = 4e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTVDDGPLR LDDPE Sbjct: 111 QPEAVVHNIVFWTNGFTVDDGPLRRLDDPE 140 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+P+K NDVD IFN+A+Q Sbjct: 56 QDPTKGNDVDAIFNQARQ 73 >ref|XP_021635644.1| plant UBX domain-containing protein 4-like [Hevea brasiliensis] Length = 304 Score = 57.0 bits (136), Expect(2) = 4e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 110 QPEAVIHNIVFWSNGFTVNDGPLRRLDDPE 139 Score = 32.7 bits (73), Expect(2) = 4e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 55 QDPSKGNDVDAIFNQARQ 72 >ref|XP_020221583.1| plant UBX domain-containing protein 4-like [Cajanus cajan] gb|KYP62724.1| UBA and UBX domain-containing protein At4g15410 family [Cajanus cajan] Length = 303 Score = 57.0 bits (136), Expect(2) = 4e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+I+FWSNGFTV+DGPLR LDDPE Sbjct: 110 QPEAVVHNIIFWSNGFTVNDGPLRRLDDPE 139 Score = 32.7 bits (73), Expect(2) = 4e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 55 QDPSKGNDVDAIFNQARQ 72 >ref|XP_019429919.1| PREDICTED: plant UBX domain-containing protein 4-like [Lupinus angustifolius] gb|OIW19845.1| hypothetical protein TanjilG_27202 [Lupinus angustifolius] Length = 304 Score = 57.8 bits (138), Expect(2) = 5e-09 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFWSNGFTV+DGPLR+LDDPE Sbjct: 110 QPEAVVHNIVFWSNGFTVNDGPLRSLDDPE 139 Score = 31.6 bits (70), Expect(2) = 5e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+P+K NDVD IFN+A+Q Sbjct: 55 QDPTKGNDVDAIFNQARQ 72 >ref|XP_020226949.1| plant UBX domain-containing protein 4-like [Cajanus cajan] gb|KYP58274.1| UBA and UBX domain-containing protein At4g15410 family [Cajanus cajan] Length = 301 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTV+DGPLR+LDDPE Sbjct: 109 QPEAVVHNIVFWTNGFTVNDGPLRSLDDPE 138 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 54 QDPSKGNDVDAIFNQARQ 71 >ref|XP_016195483.1| plant UBX domain-containing protein 4 [Arachis ipaensis] Length = 300 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTV+DGPLR+LDDPE Sbjct: 109 QPEAVVHNIVFWTNGFTVNDGPLRSLDDPE 138 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 54 QDPSKGNDVDAIFNQARQ 71 >ref|XP_015940884.1| plant UBX domain-containing protein 4 [Arachis duranensis] Length = 300 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTV+DGPLR+LDDPE Sbjct: 109 QPEAVVHNIVFWTNGFTVNDGPLRSLDDPE 138 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 54 QDPSKGNDVDAIFNQARQ 71 >ref|XP_017436949.1| PREDICTED: plant UBX domain-containing protein 4 [Vigna angularis] dbj|BAT87503.1| hypothetical protein VIGAN_05088000 [Vigna angularis var. angularis] Length = 298 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP + H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 105 NNQQPESVVHNIVFWSNGFTVNDGPLRRLDDPE 137 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDAIFNQARQ 69 >ref|XP_014518440.1| plant UBX domain-containing protein 4-like [Vigna radiata var. radiata] Length = 298 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP + H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 105 NNQQPESVVHNIVFWSNGFTVNDGPLRRLDDPE 137 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDAIFNQARQ 69 >gb|KOM53285.1| hypothetical protein LR48_Vigan09g194400 [Vigna angularis] Length = 267 Score = 56.6 bits (135), Expect(2) = 5e-09 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -1 Query: 344 DQHQPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 + QP + H+IVFWSNGFTV+DGPLR LDDPE Sbjct: 105 NNQQPESVVHNIVFWSNGFTVNDGPLRRLDDPE 137 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK NDVD IFN+A+Q Sbjct: 52 QDPSKGNDVDAIFNQARQ 69 >ref|XP_021599767.1| plant UBX domain-containing protein 4-like isoform X1 [Manihot esculenta] gb|OAY24587.1| hypothetical protein MANES_17G027200 [Manihot esculenta] Length = 304 Score = 55.8 bits (133), Expect(2) = 6e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 335 QPAAAAHDIVFWSNGFTVDDGPLRNLDDPE 246 QP A H+IVFW+NGFTV+DGPLR LDDPE Sbjct: 110 QPEAVIHNIVFWTNGFTVNDGPLRRLDDPE 139 Score = 33.1 bits (74), Expect(2) = 6e-09 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 402 QEPSKSNDVDLIFNEAKQ 349 Q+PSK+NDVD IFN+A+Q Sbjct: 55 QDPSKANDVDAIFNQARQ 72