BLASTX nr result
ID: Astragalus22_contig00014941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00014941 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX95623.1| hypothetical protein L195_g018816 [Trifolium prat... 60 4e-08 ref|XP_013456458.1| hypothetical protein MTR_4g073490 [Medicago ... 56 6e-07 >gb|PNX95623.1| hypothetical protein L195_g018816 [Trifolium pratense] gb|PNX99613.1| hypothetical protein L195_g022882 [Trifolium pratense] Length = 185 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/92 (30%), Positives = 50/92 (54%) Frame = -3 Query: 347 DYENLSLPNGVNIDEFQKIIRMVVETNQMIESQEDLPPIMVYAQPEALKKVMDQLVGDFK 168 D+ENL L V +++ +++++ +E +I+ EDLPPI VY+ P+ K+ +D+ F Sbjct: 20 DFENLGLDKDVTLEKMKQVLKAKLEDKNVIKVWEDLPPIEVYSNPKYCKRFLDKWSEGFN 79 Query: 167 YHPTERGERRTLQTGRF*KQLAWHYKMKWQGK 72 Y+PT +G + W K+KW + Sbjct: 80 YNPTPKGNNEA-DYEILKDIIFWRLKVKWNAE 110 >ref|XP_013456458.1| hypothetical protein MTR_4g073490 [Medicago truncatula] gb|KEH30489.1| hypothetical protein MTR_4g073490 [Medicago truncatula] Length = 170 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/73 (34%), Positives = 44/73 (60%) Frame = -3 Query: 365 HVVLL*DYENLSLPNGVNIDEFQKIIRMVVETNQMIESQEDLPPIMVYAQPEALKKVMDQ 186 HV ++ DYEN+ LP ++DEF+ + MV++ N++ +S++ LP I+ + KK+ Sbjct: 79 HVGIVWDYENIPLPKNFDVDEFEYAMIMVLKKNELAKSEDGLPKILTFGHFVETKKLRAN 138 Query: 185 LVGDFKYHPTERG 147 + + KY T RG Sbjct: 139 ITSNIKYQRTMRG 151