BLASTX nr result
ID: Astragalus22_contig00014851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00014851 (886 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT96785.1| hypothetical protein VIGAN_09008500 [Vigna angul... 60 5e-08 gb|OIW00454.1| hypothetical protein TanjilG_05804 [Lupinus angus... 59 1e-07 >dbj|BAT96785.1| hypothetical protein VIGAN_09008500 [Vigna angularis var. angularis] Length = 91 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 252 KKIWNMTKQKTTIMSSTLSTQHELIKHECKVSPPSLIIIA 133 KKI TK+KT IMSSTLS QHELIKHEC+V P SLI+IA Sbjct: 14 KKIEKRTKKKTGIMSSTLSMQHELIKHECRVFPSSLIVIA 53 >gb|OIW00454.1| hypothetical protein TanjilG_05804 [Lupinus angustifolius] Length = 574 Score = 58.9 bits (141), Expect(2) = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 131 HAIMMRDGGDTLHSCLINSCCVLKVDDIIVV 223 +AIMMRDGG+TLHSCLINSCCV KVDDII++ Sbjct: 188 NAIMMRDGGNTLHSCLINSCCVPKVDDIILL 218 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 238 IPNFFPSRTS*NGDFTCTLI 297 IPNF P S NG+F C L+ Sbjct: 223 IPNFLPLCLSYNGNFICVLM 242