BLASTX nr result
ID: Astragalus22_contig00014749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00014749 (348 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX88593.1| hypothetical protein L195_g044699 [Trifolium prat... 59 1e-08 dbj|GAU24005.1| hypothetical protein TSUD_328070 [Trifolium subt... 53 1e-06 ref|XP_013458227.1| hypothetical protein MTR_4g118020 [Medicago ... 55 2e-06 >gb|PNX88593.1| hypothetical protein L195_g044699 [Trifolium pratense] Length = 120 Score = 58.5 bits (140), Expect = 1e-08 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = -2 Query: 260 PVLNTKWTPPCCDSFKLNVDAAQAGDGV-WSFVAVVSDASYAVGAAACWSTLCLAEPSVA 84 P+ + WT P + LNVDAA + W F VV D V AA+CW L L+ V Sbjct: 2 PISDVHWTTPPGGYYDLNVDAAGPIERCRWGFGVVVRDEYGVVVAASCWQVLSLSNSEVK 61 Query: 83 EAMALRQGLLFPRDCVLANLV 21 EA+A+R+GL F +D N++ Sbjct: 62 EAVAMRKGLEFAKDMSFLNVI 82 >dbj|GAU24005.1| hypothetical protein TSUD_328070 [Trifolium subterraneum] Length = 92 Score = 52.8 bits (125), Expect = 1e-06 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = -2 Query: 260 PVLNTKWTPPCCDSFKLNVDAAQAGDG-VWSFVAVVSDASYAVGAAACWSTLCLAEPSVA 84 P+ + WT P + LNVDAA +G W VV D V AA+ W L + +A Sbjct: 9 PIYDVHWTTPLSGYYNLNVDAAGPIEGGKWGIGVVVRDVDSVVVAASYWQIFSLPDSEIA 68 Query: 83 EAMALR-QGLLFPRDCVLANLVA 18 E +A+R +GL F + NL+A Sbjct: 69 EVLAMRWKGLEFAKKLSFVNLIA 91 >ref|XP_013458227.1| hypothetical protein MTR_4g118020 [Medicago truncatula] gb|KEH32258.1| hypothetical protein MTR_4g118020 [Medicago truncatula] Length = 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/68 (44%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -2 Query: 260 PVLNTKWTPPCCDSFKLNVDAAQAGD-GVWSFVAVVSDASYAVGAAACWSTLCLAEPSVA 84 P N W+ P SFKLN DAA D W +VV DA V A ACW+ L E +A Sbjct: 168 PNCNVHWSAPVSGSFKLNADAAGLDDEDRWGLASVVRDAEAVVVAVACWNRPLLLESDIA 227 Query: 83 EAMALRQG 60 E MA +G Sbjct: 228 ECMATLKG 235