BLASTX nr result
ID: Astragalus22_contig00013634
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00013634 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013448909.1| hypothetical protein MTR_7g062650 [Medicago ... 59 1e-07 gb|PNY03532.1| hypothetical protein L195_g026864 [Trifolium prat... 59 3e-07 >ref|XP_013448909.1| hypothetical protein MTR_7g062650 [Medicago truncatula] gb|KEH22936.1| hypothetical protein MTR_7g062650 [Medicago truncatula] Length = 183 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 173 RKMIYKGNVLAQTDLLKWKTLPLKHGTCEY*SLRTRMF 286 RKMI G+V A L+KWKTLPLKHGTC+Y SLRTRMF Sbjct: 135 RKMINWGSVSALKVLIKWKTLPLKHGTCDYSSLRTRMF 172 >gb|PNY03532.1| hypothetical protein L195_g026864 [Trifolium pratense] Length = 400 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = +2 Query: 173 RKMIYKGNVLAQTDLLKWKTLPLKHGTCEY*SLRTRMF*RRGYCDSIF 316 RKMI +GNV L+KWKTLP KHGTC+Y SLRTRMF G F Sbjct: 353 RKMINRGNVRDAKILIKWKTLPRKHGTCDYSSLRTRMFEGEGIVTRFF 400