BLASTX nr result
ID: Astragalus22_contig00013462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00013462 (805 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW15027.1| hypothetical protein TanjilG_24136 [Lupinus angus... 64 1e-07 >gb|OIW15027.1| hypothetical protein TanjilG_24136 [Lupinus angustifolius] Length = 891 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 726 NHNLHEKQVKTAGQGHRPEAQMERKAWSHMALVPPTRTKCEI 601 NH+L EKQ +T GQGHRPE QMERKAWS M +V P R K EI Sbjct: 824 NHDLREKQAETTGQGHRPEVQMERKAWSLMEMVLPARAKGEI 865