BLASTX nr result
ID: Astragalus22_contig00013327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00013327 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN35817.1| Retrovirus-related Pol polyprotein from transposo... 54 6e-11 dbj|GAU35215.1| hypothetical protein TSUD_204910 [Trifolium subt... 52 1e-10 dbj|GAU50483.1| hypothetical protein TSUD_409690 [Trifolium subt... 52 1e-10 dbj|GAU37611.1| hypothetical protein TSUD_365320 [Trifolium subt... 52 1e-10 gb|PNX70198.1| cationic amino acid transporter 1-like protein, p... 52 2e-10 dbj|GAU33196.1| hypothetical protein TSUD_206550 [Trifolium subt... 52 4e-10 dbj|GAU32293.1| hypothetical protein TSUD_63100 [Trifolium subte... 52 9e-10 dbj|GAU39052.1| hypothetical protein TSUD_396570 [Trifolium subt... 52 9e-10 dbj|GAU42500.1| hypothetical protein TSUD_101130 [Trifolium subt... 48 9e-10 gb|PNX68532.1| copia-type polyprotein [Trifolium pratense] 53 1e-09 gb|PNY02829.1| copia protein [Trifolium pratense] 52 1e-09 dbj|GAU45892.1| hypothetical protein TSUD_24940 [Trifolium subte... 49 2e-09 gb|PNY18017.1| copia-type polyprotein [Trifolium pratense] 49 3e-09 dbj|GAU42845.1| hypothetical protein TSUD_387380 [Trifolium subt... 47 3e-09 dbj|GAU43786.1| hypothetical protein TSUD_378110 [Trifolium subt... 48 3e-09 dbj|GAU25894.1| hypothetical protein TSUD_376130 [Trifolium subt... 50 4e-09 dbj|GAU22332.1| hypothetical protein TSUD_106600 [Trifolium subt... 47 4e-09 dbj|GAU22730.1| hypothetical protein TSUD_138550 [Trifolium subt... 49 4e-09 dbj|GAU50842.1| hypothetical protein TSUD_232190 [Trifolium subt... 52 4e-09 gb|KYP32045.1| Retrovirus-related Pol polyprotein from transposo... 49 6e-09 >gb|KHN35817.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 180 Score = 53.5 bits (127), Expect(2) = 6e-11 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 IWL SLL+ELK +P+ L ID+KS INLAKNP+SH K H Sbjct: 84 IWLDSLLDELKFETKKPIKLLIDNKSAINLAKNPVSHGKSKH 125 Score = 41.2 bits (95), Expect(2) = 6e-11 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH +SK+IETRFHFLREQVN K+ Sbjct: 119 SHGKSKHIETRFHFLREQVNNGKL 142 >dbj|GAU35215.1| hypothetical protein TSUD_204910 [Trifolium subterraneum] Length = 1149 Score = 52.4 bits (124), Expect(2) = 1e-10 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 IWL SLL +++ L EP+ L +D+KS INLAKNPISH + H Sbjct: 1050 IWLESLLKDIQVELTEPIQLLVDNKSAINLAKNPISHGRSKH 1091 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH RSK+IETRFHF+REQVN +I Sbjct: 1085 SHGRSKHIETRFHFIREQVNNGRI 1108 >dbj|GAU50483.1| hypothetical protein TSUD_409690 [Trifolium subterraneum] Length = 1073 Score = 52.4 bits (124), Expect(2) = 1e-10 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 IWL SLL +++ L EP+ L +D+KS INLAKNPISH + H Sbjct: 974 IWLESLLKDIQVELTEPIQLLVDNKSAINLAKNPISHGRSKH 1015 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH RSK+IETRFHF+REQVN +I Sbjct: 1009 SHGRSKHIETRFHFIREQVNNGRI 1032 >dbj|GAU37611.1| hypothetical protein TSUD_365320 [Trifolium subterraneum] Length = 718 Score = 52.4 bits (124), Expect(2) = 1e-10 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 IWL SLL +++ L EP+ L +D+KS INLAKNPISH + H Sbjct: 619 IWLESLLKDIQVELTEPIQLLVDNKSAINLAKNPISHGRSKH 660 Score = 41.2 bits (95), Expect(2) = 1e-10 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH RSK+IETRFHF+REQVN +I Sbjct: 654 SHGRSKHIETRFHFIREQVNNGRI 677 >gb|PNX70198.1| cationic amino acid transporter 1-like protein, partial [Trifolium pratense] Length = 199 Score = 51.6 bits (122), Expect(2) = 2e-10 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 IWL SLL ++K L EP+ L +D+KS INLA+NPISH + H Sbjct: 125 IWLESLLKDIKIELTEPMQLLVDNKSAINLARNPISHGRSKH 166 Score = 41.6 bits (96), Expect(2) = 2e-10 Identities = 18/24 (75%), Positives = 22/24 (91%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH RSK+IETRFHF+R+QVN+ KI Sbjct: 160 SHGRSKHIETRFHFIRDQVNKGKI 183 >dbj|GAU33196.1| hypothetical protein TSUD_206550 [Trifolium subterraneum] Length = 1084 Score = 51.6 bits (122), Expect(2) = 4e-10 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL SLL+ELK +PV LN+D+KS I+LA+NPI+H + H Sbjct: 986 VWLESLLDELKIKYVKPVKLNVDNKSAISLARNPIAHGRSKH 1027 Score = 40.0 bits (92), Expect(2) = 4e-10 Identities = 16/24 (66%), Positives = 23/24 (95%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 +H RSK+IET++HFLREQV++EK+ Sbjct: 1021 AHGRSKHIETKYHFLREQVSKEKL 1044 >dbj|GAU32293.1| hypothetical protein TSUD_63100 [Trifolium subterraneum] Length = 1342 Score = 51.6 bits (122), Expect(2) = 9e-10 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL SLL+ELK +PV LN+D+KS I+LA+NPI+H + H Sbjct: 1230 VWLESLLDELKIKYVKPVKLNVDNKSAISLARNPIAHGRSKH 1271 Score = 38.9 bits (89), Expect(2) = 9e-10 Identities = 15/24 (62%), Positives = 23/24 (95%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 +H RSK+IET++HFLR+QV++EK+ Sbjct: 1265 AHGRSKHIETKYHFLRDQVSKEKL 1288 >dbj|GAU39052.1| hypothetical protein TSUD_396570 [Trifolium subterraneum] Length = 1309 Score = 51.6 bits (122), Expect(2) = 9e-10 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL SLL+ELK +PV LN+D+KS I+LA+NPI+H + H Sbjct: 1211 VWLESLLDELKIKYVKPVKLNVDNKSAISLARNPIAHGRSKH 1252 Score = 38.9 bits (89), Expect(2) = 9e-10 Identities = 15/24 (62%), Positives = 23/24 (95%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 +H RSK+IET++HFLR+QV++EK+ Sbjct: 1246 AHGRSKHIETKYHFLRDQVSKEKL 1269 >dbj|GAU42500.1| hypothetical protein TSUD_101130 [Trifolium subterraneum] Length = 1120 Score = 47.8 bits (112), Expect(2) = 9e-10 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 WL SLL+E+K V+L ID+KS INLAKNP+SH K H Sbjct: 1023 WLQSLLSEMKITDNITVMLKIDNKSAINLAKNPVSHGKSKH 1063 Score = 42.7 bits (99), Expect(2) = 9e-10 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 SH +SK+IETRFHFLR+QVN+ K+N Sbjct: 1057 SHGKSKHIETRFHFLRDQVNKGKLN 1081 >gb|PNX68532.1| copia-type polyprotein [Trifolium pratense] Length = 194 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +1 Query: 7 RIIWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +++WL S+L ELK L +P+ L ID+KS INLAKNP+SH + H Sbjct: 98 QMVWLDSVLRELKCELQKPLKLMIDNKSAINLAKNPVSHGRSKH 141 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQV 172 SH RSK+IETRFHF+REQV Sbjct: 135 SHGRSKHIETRFHFIREQV 153 >gb|PNY02829.1| copia protein [Trifolium pratense] Length = 157 Score = 51.6 bits (122), Expect(2) = 1e-09 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL SLL ELK N +P+ LN D+KS I+ AKNPI+H + H Sbjct: 57 VWLESLLEELKINYVKPIRLNFDNKSAISFAKNPIAHGRSKH 98 Score = 38.5 bits (88), Expect(2) = 1e-09 Identities = 15/25 (60%), Positives = 23/25 (92%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 +H RSK+IET++HFLR+QV++ K+N Sbjct: 92 AHGRSKHIETKYHFLRDQVSKGKLN 116 >dbj|GAU45892.1| hypothetical protein TSUD_24940 [Trifolium subterraneum] Length = 844 Score = 48.5 bits (114), Expect(2) = 2e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 WL SLL+E+K V+L ID+KSTINLAKNP+SH K H Sbjct: 747 WLQSLLSEMKIIDNITVMLKIDNKSTINLAKNPVSHGKSKH 787 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 SH +SK+IETRFHFLR+QVN+ K++ Sbjct: 781 SHGKSKHIETRFHFLRDQVNKGKLS 805 >gb|PNY18017.1| copia-type polyprotein [Trifolium pratense] Length = 999 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 21/42 (50%), Positives = 30/42 (71%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +W+ S+L ELK ++ P+ L ID+KS INLAKNP+ H + H Sbjct: 903 LWIESVLKELKVDVERPIKLQIDNKSAINLAKNPVLHGRSKH 944 Score = 40.0 bits (92), Expect(2) = 3e-09 Identities = 21/31 (67%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = +2 Query: 119 HMRSKYIETRFHFLREQVNE---EKIN*ASG 202 H RSK+IETRFHFLREQVN+ E I+ A+G Sbjct: 939 HGRSKHIETRFHFLREQVNQGSLEVIHCATG 969 >dbj|GAU42845.1| hypothetical protein TSUD_387380 [Trifolium subterraneum] Length = 1239 Score = 47.4 bits (111), Expect(2) = 3e-09 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 I L SLL +++ L EP+ L +D+KS INLAKNPISH + H Sbjct: 1140 IGLESLLKDIQVELTEPIQLLVDNKSAINLAKNPISHGRSKH 1181 Score = 41.2 bits (95), Expect(2) = 3e-09 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 SH RSK+IETRFHF+REQVN +I Sbjct: 1175 SHGRSKHIETRFHFIREQVNNGRI 1198 >dbj|GAU43786.1| hypothetical protein TSUD_378110 [Trifolium subterraneum] Length = 1166 Score = 47.8 bits (112), Expect(2) = 3e-09 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 WL SLL+E+K V+L ID+KS INLAKNP+SH K H Sbjct: 1069 WLQSLLSEMKITDNITVMLKIDNKSAINLAKNPVSHGKSKH 1109 Score = 40.8 bits (94), Expect(2) = 3e-09 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 SH +SK+IETRFHFLR+QVN+ K++ Sbjct: 1103 SHGKSKHIETRFHFLRDQVNKGKLS 1127 >dbj|GAU25894.1| hypothetical protein TSUD_376130 [Trifolium subterraneum] Length = 1192 Score = 49.7 bits (117), Expect(2) = 4e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 WL SLL+E+K V+L ID+KSTINLAKNP+SH K H Sbjct: 1095 WLQSLLSEMKITDNITVMLKIDNKSTINLAKNPVSHGKSKH 1135 Score = 38.5 bits (88), Expect(2) = 4e-09 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 SH +SK+IETRFHFL +QVN+ K++ Sbjct: 1129 SHGKSKHIETRFHFLMDQVNKGKLS 1153 >dbj|GAU22332.1| hypothetical protein TSUD_106600 [Trifolium subterraneum] Length = 1171 Score = 47.4 bits (111), Expect(2) = 4e-09 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 W+ SLLNE+K ++L ID+KS INLAKNP+SH K H Sbjct: 1074 WMQSLLNEMKIIDNITIMLKIDNKSAINLAKNPVSHGKSKH 1114 Score = 40.8 bits (94), Expect(2) = 4e-09 Identities = 17/25 (68%), Positives = 23/25 (92%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKIN 190 SH +SK+IETRFHFLR+QVN+ K++ Sbjct: 1108 SHGKSKHIETRFHFLRDQVNKGKLS 1132 >dbj|GAU22730.1| hypothetical protein TSUD_138550 [Trifolium subterraneum] Length = 1162 Score = 48.5 bits (114), Expect(2) = 4e-09 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 16 WLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 WL SLL+E+K V+L ID+KSTINLAKNP+SH K H Sbjct: 1065 WLQSLLSEMKIIDNITVMLKIDNKSTINLAKNPVSHGKSKH 1105 Score = 39.7 bits (91), Expect(2) = 4e-09 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEK 184 SH +SK+IETRFHFLR+QVN+ K Sbjct: 1099 SHGKSKHIETRFHFLRDQVNKGK 1121 >dbj|GAU50842.1| hypothetical protein TSUD_232190 [Trifolium subterraneum] Length = 1078 Score = 51.6 bits (122), Expect(2) = 4e-09 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL SLL+ELK +PV LN+D+KS I+LA+NPI+H + H Sbjct: 980 VWLESLLDELKIKYVKPVKLNVDNKSAISLARNPIAHGRSKH 1021 Score = 36.6 bits (83), Expect(2) = 4e-09 Identities = 14/24 (58%), Positives = 22/24 (91%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 +H RSK+IE ++HFLR+QV++EK+ Sbjct: 1015 AHGRSKHIEIKYHFLRDQVSKEKL 1038 >gb|KYP32045.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1205 Score = 48.9 bits (115), Expect(2) = 6e-09 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = +1 Query: 13 IWLSSLLNELKGNLAEPVLLNIDDKSTINLAKNPISHEK*VH 138 +WL +LL ELK E +LL +D+KS INLAKNP++H + H Sbjct: 1107 LWLETLLEELKTETEEGMLLMVDNKSAINLAKNPVAHGRSKH 1148 Score = 38.9 bits (89), Expect(2) = 6e-09 Identities = 15/24 (62%), Positives = 22/24 (91%) Frame = +2 Query: 116 SHMRSKYIETRFHFLREQVNEEKI 187 +H RSK+IETRFHFLR+Q+++ K+ Sbjct: 1142 AHGRSKHIETRFHFLRDQISKRKL 1165