BLASTX nr result
ID: Astragalus22_contig00012425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00012425 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009318202.1| ribosomal protein L32 (chloroplast) [Corylus... 67 4e-11 >ref|YP_009318202.1| ribosomal protein L32 (chloroplast) [Corylus avellana] ref|YP_009318282.1| ribosomal protein L32 (chloroplast) [Corylus heterophylla] ref|YP_009318125.1| ribosomal protein L32 (chloroplast) [Corylus fargesii] ref|YP_009331522.1| ribosomal protein L32 (chloroplast) [Corylus chinensis] gb|AOZ20326.1| ribosomal protein L32 (chloroplast) [Corylus fargesii] gb|AOZ20404.1| ribosomal protein L32 (chloroplast) [Corylus avellana] gb|AOZ20484.1| ribosomal protein L32 (chloroplast) [Corylus heterophylla] gb|APF31771.1| ribosomal protein L32 (chloroplast) [Corylus chinensis] Length = 56 Score = 66.6 bits (161), Expect = 4e-11 Identities = 33/52 (63%), Positives = 36/52 (69%) Frame = +1 Query: 103 FYLLQKKLFEFPVKMDCANEKAFNAVQYPXXXXXXXXXXXXDIEVRFFGTAI 258 ++LL KKLFEFPV+ D ANEKAFNA QYP DIEVRFFGTAI Sbjct: 2 YFLLYKKLFEFPVERDFANEKAFNATQYPSIFQIFLRIRFFDIEVRFFGTAI 53