BLASTX nr result
ID: Astragalus22_contig00012356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00012356 (994 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP74913.1| Arginine/serine-rich-splicing factor RSP40 [Cajan... 104 2e-21 >gb|KYP74913.1| Arginine/serine-rich-splicing factor RSP40 [Cajanus cajan] Length = 424 Score = 104 bits (260), Expect = 2e-21 Identities = 48/57 (84%), Positives = 50/57 (87%) Frame = +2 Query: 824 HFWTCFEVEILPTSQQRKQNRWRRHSLSTDPP*DLHFWILVLDTNLFITQGFAFIYM 994 HFWTCFEVEILPTSQQR+QN WRRHSLS DP LHFW+LVLDTNLF QGFAFIYM Sbjct: 37 HFWTCFEVEILPTSQQRQQNGWRRHSLSIDP---LHFWVLVLDTNLFTNQGFAFIYM 90