BLASTX nr result
ID: Astragalus22_contig00012124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00012124 (315 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004508602.1| PREDICTED: protein CHAPERONE-LIKE PROTEIN OF... 67 3e-11 gb|AFK46032.1| unknown [Medicago truncatula] 59 5e-08 ref|XP_003609152.1| cell growth defect factor-like protein [Medi... 59 5e-08 dbj|GAU19018.1| hypothetical protein TSUD_193560 [Trifolium subt... 50 9e-06 >ref|XP_004508602.1| PREDICTED: protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic [Cicer arietinum] Length = 251 Score = 67.4 bits (163), Expect = 3e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 186 MVALSLSTSNFATAFLGKKLPLRENTRKLITFSESSCRTRCAV 314 MV+LSLS+ NFATAFL KKLPLRENTRK TFS+ S RTRCAV Sbjct: 1 MVSLSLSSPNFATAFLAKKLPLRENTRKSATFSDVSFRTRCAV 43 >gb|AFK46032.1| unknown [Medicago truncatula] Length = 251 Score = 58.9 bits (141), Expect = 5e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +3 Query: 186 MVALSLSTSNFATAFLGKKLPLRENTRKLITFSESSCRTRCAV 314 M +LSLS+ NF TAFL KKLPLRENTR TF S RT+CAV Sbjct: 1 MASLSLSSPNFPTAFLSKKLPLRENTRNFTTFRHVSFRTKCAV 43 >ref|XP_003609152.1| cell growth defect factor-like protein [Medicago truncatula] gb|AES91349.1| cell growth defect factor-like protein [Medicago truncatula] Length = 251 Score = 58.9 bits (141), Expect = 5e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +3 Query: 186 MVALSLSTSNFATAFLGKKLPLRENTRKLITFSESSCRTRCAV 314 M +LSLS+ NF TAFL KKLPLRENTR TF S RT+CAV Sbjct: 1 MASLSLSSPNFPTAFLSKKLPLRENTRNFTTFRHVSFRTKCAV 43 >dbj|GAU19018.1| hypothetical protein TSUD_193560 [Trifolium subterraneum] Length = 100 Score = 50.4 bits (119), Expect = 9e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 186 MVALSLSTSNFATAFLGKKLPLRENTRKLITFSESSCRTRCAV 314 MV+LSLS+ NFATA+L KLPLRENTRK + S R RCAV Sbjct: 1 MVSLSLSSPNFATAYLANKLPLRENTRKP---THVSFRIRCAV 40