BLASTX nr result
ID: Astragalus22_contig00012043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00012043 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX95252.1| putative ubiquitin-conjugating enzyme E2 25-like ... 60 3e-07 >gb|PNX95252.1| putative ubiquitin-conjugating enzyme E2 25-like protein [Trifolium pratense] Length = 563 Score = 60.5 bits (145), Expect = 3e-07 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 339 FLDPDVIETPPP-IHNPSNSTNHKQKXXXXXXXXXXXXXXXXXXXXXXGEKVAKNSKGKE 515 F+DPDVIE PPP HN ++ ++K GEKV K +KGK Sbjct: 39 FMDPDVIEIPPPPTHNKPSNLLKQKKEAIVPDVIDIDNDEDSSDLVLVGEKVVKMNKGKT 98 Query: 516 IESIHAGYGDHQT 554 IES+H GYGDHQT Sbjct: 99 IESVHNGYGDHQT 111