BLASTX nr result
ID: Astragalus22_contig00012013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00012013 (341 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22298.3| unnamed protein product, partial [Vitis vinifera] 63 6e-11 ref|XP_021297657.1| biotin carboxyl carrier protein of acetyl-Co... 67 9e-11 gb|PPD82726.1| hypothetical protein GOBAR_DD20341 [Gossypium bar... 66 1e-10 ref|XP_007029252.1| PREDICTED: biotin carboxyl carrier protein o... 67 1e-10 gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] 66 1e-10 gb|PKI47754.1| hypothetical protein CRG98_031887 [Punica granatum] 65 1e-10 gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het... 67 1e-10 gb|KDP27226.1| hypothetical protein JCGZ_19925 [Jatropha curcas] 66 1e-10 gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] 66 1e-10 ref|XP_021633432.1| biotin carboxyl carrier protein of acetyl-Co... 66 2e-10 ref|XP_003618716.1| biotin carboxyl carrier acetyl-CoA carboxyla... 66 2e-10 ref|XP_012460343.1| PREDICTED: biotin carboxyl carrier protein o... 66 2e-10 gb|KJB75634.1| hypothetical protein B456_012G049400 [Gossypium r... 66 2e-10 gb|KJB75636.1| hypothetical protein B456_012G049400 [Gossypium r... 66 2e-10 ref|XP_001762374.1| predicted protein [Physcomitrella patens] 62 2e-10 ref|XP_019080687.1| PREDICTED: biotin carboxyl carrier protein o... 63 2e-10 ref|XP_021672936.1| biotin carboxyl carrier protein of acetyl-Co... 66 2e-10 gb|KJB81167.1| hypothetical protein B456_013G132300 [Gossypium r... 65 2e-10 ref|XP_021687259.1| biotin carboxyl carrier protein of acetyl-Co... 66 2e-10 gb|KJB66287.1| hypothetical protein B456_010G135200 [Gossypium r... 64 2e-10 >emb|CBI22298.3| unnamed protein product, partial [Vitis vinifera] Length = 71 Score = 63.2 bits (152), Expect = 6e-11 Identities = 33/48 (68%), Positives = 34/48 (70%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTI EIL EDGK VS Sbjct: 14 PPFVMVGDKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVS 61 >ref|XP_021297657.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Herrania umbratica] Length = 288 Score = 67.0 bits (162), Expect = 9e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTI+EILVEDGKSVS Sbjct: 231 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTISEILVEDGKSVS 278 >gb|PPD82726.1| hypothetical protein GOBAR_DD20341 [Gossypium barbadense] Length = 237 Score = 66.2 bits (160), Expect = 1e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGT+ EILVEDGKSVS Sbjct: 176 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTVTEILVEDGKSVS 223 >ref|XP_007029252.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Theobroma cacao] gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 66.6 bits (161), Expect = 1e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGTI EILVEDGKSVS Sbjct: 222 PPFVKVGDKVQKGQVICIIEAMKLMNEIEADQSGTIVEILVEDGKSVS 269 >gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 66.2 bits (160), Expect = 1e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTIAEILVEDGK VS Sbjct: 195 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVS 242 >gb|PKI47754.1| hypothetical protein CRG98_031887 [Punica granatum] Length = 166 Score = 64.7 bits (156), Expect = 1e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMN+IEADQSGT+AEILVEDGK VS Sbjct: 109 PPFVKVGDKVQKGQVLCIIEAMKLMNDIEADQSGTVAEILVEDGKPVS 156 >gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 66.6 bits (161), Expect = 1e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGTI EILVEDGKSVS Sbjct: 253 PPFVKVGDKVQKGQVICIIEAMKLMNEIEADQSGTIVEILVEDGKSVS 300 >gb|KDP27226.1| hypothetical protein JCGZ_19925 [Jatropha curcas] Length = 270 Score = 66.2 bits (160), Expect = 1e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTIAEILVEDGK VS Sbjct: 213 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVS 260 >gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 66.2 bits (160), Expect = 1e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTIAEILVEDGK VS Sbjct: 213 PPFVKVRDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVS 260 >ref|XP_021633432.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Manihot esculenta] gb|OAY60239.1| hypothetical protein MANES_01G097500 [Manihot esculenta] Length = 271 Score = 66.2 bits (160), Expect = 2e-10 Identities = 35/48 (72%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTIAEILVEDGK VS Sbjct: 214 PPFVKVGDRVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVS 261 >ref|XP_003618716.1| biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] gb|AES74934.1| biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGTIAEILVEDGK VS Sbjct: 221 PPFVQVGDTVQKGQVICIIEAMKLMNEIEADQSGTIAEILVEDGKPVS 268 >ref|XP_012460343.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium raimondii] gb|KJB75633.1| hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 290 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGT+ EILVEDGKSVS Sbjct: 233 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTVTEILVEDGKSVS 280 >gb|KJB75634.1| hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 291 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGT+ EILVEDGKSVS Sbjct: 234 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTVTEILVEDGKSVS 281 >gb|KJB75636.1| hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 294 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGT+ EILVEDGKSVS Sbjct: 233 PPFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTVTEILVEDGKSVS 280 >ref|XP_001762374.1| predicted protein [Physcomitrella patens] Length = 57 Score = 61.6 bits (148), Expect = 2e-10 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PP++ VCI+EAMKLMNEIEADQSGTI EIL EDGK VS Sbjct: 3 PPYVKVGDKVTKGQVVCIVEAMKLMNEIEADQSGTIVEILAEDGKPVS 50 >ref|XP_019080687.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X1 [Vitis vinifera] Length = 119 Score = 63.2 bits (152), Expect = 2e-10 Identities = 33/48 (68%), Positives = 34/48 (70%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ VCIIEAMKLMNEIEADQSGTI EIL EDGK VS Sbjct: 62 PPFVMVGDKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVS 109 >ref|XP_021672936.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Hevea brasiliensis] Length = 271 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGT+AEILVEDGK VS Sbjct: 214 PPFVKVGDKVQKGQVICIIEAMKLMNEIEADQSGTVAEILVEDGKPVS 261 >gb|KJB81167.1| hypothetical protein B456_013G132300 [Gossypium raimondii] Length = 243 Score = 65.5 bits (158), Expect = 2e-10 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGTI EILVEDGK+VS Sbjct: 186 PPFVKVGDKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILVEDGKAVS 233 >ref|XP_021687259.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Hevea brasiliensis] Length = 286 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGT+AEILVEDGK VS Sbjct: 229 PPFVKVGDKVQKGQVICIIEAMKLMNEIEADQSGTVAEILVEDGKPVS 276 >gb|KJB66287.1| hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 63.9 bits (154), Expect = 2e-10 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = -3 Query: 339 PPFIXXXXXXXXXXXVCIIEAMKLMNEIEADQSGTIAEILVEDGKSVS 196 PPF+ +CIIEAMKLMNEIEADQSGTI EIL EDGK+VS Sbjct: 104 PPFVKVGDKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKAVS 151