BLASTX nr result
ID: Astragalus22_contig00010729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00010729 (328 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013458026.1| Dof domain zinc finger protein [Medicago tru... 100 7e-23 ref|XP_019451819.1| PREDICTED: dof zinc finger protein DOF5.4-li... 98 2e-22 gb|PNX74758.1| dof zinc finger protein [Trifolium pratense] 98 2e-22 gb|OIW19680.1| hypothetical protein TanjilG_18490 [Lupinus angus... 98 2e-22 ref|XP_019439011.1| PREDICTED: dof zinc finger protein DOF5.4-li... 98 3e-22 gb|PON46427.1| Zinc finger, Dof-type [Parasponia andersonii] 95 5e-21 ref|NP_001236530.2| Dof4 [Glycine max] >gi|947053727|gb|KRH03180... 94 6e-21 gb|ABI16005.1| Dof4 [Glycine max] 94 6e-21 ref|XP_004508651.1| PREDICTED: dof zinc finger protein DOF5.4 [C... 94 6e-21 ref|XP_010101639.1| dof zinc finger protein DOF5.4 [Morus notabi... 95 7e-21 gb|AEZ49193.1| dof-type zinc finger protein, partial [Sorghum bi... 89 8e-21 gb|EPS60475.1| hypothetical protein M569_14328, partial [Genlise... 89 9e-21 ref|XP_015883277.1| PREDICTED: dof zinc finger protein DOF5.4 [Z... 94 1e-20 gb|AJG01743.1| Dof25, partial [Cajanus cajan] 91 2e-20 ref|XP_022987278.1| dof zinc finger protein DOF5.4-like [Cucurbi... 93 2e-20 ref|XP_021809971.1| dof zinc finger protein DOF5.4 [Prunus avium] 93 3e-20 ref|XP_017430102.1| PREDICTED: dof zinc finger protein DOF5.4 is... 92 3e-20 ref|XP_014506030.1| dof zinc finger protein DOF5.4-like [Vigna r... 92 3e-20 ref|XP_007155202.1| hypothetical protein PHAVU_003G182100g [Phas... 92 3e-20 ref|XP_013618360.1| PREDICTED: dof zinc finger protein DOF5.4-li... 91 6e-20 >ref|XP_013458026.1| Dof domain zinc finger protein [Medicago truncatula] gb|KEH32057.1| Dof domain zinc finger protein [Medicago truncatula] Length = 320 Score = 99.8 bits (247), Expect = 7e-23 Identities = 47/71 (66%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPT-- 175 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR LPT Sbjct: 54 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPKKSSSSDSTVLPTTP 113 Query: 176 -PTPEHKSNSH 205 PE+KSNSH Sbjct: 114 PEAPENKSNSH 124 >ref|XP_019451819.1| PREDICTED: dof zinc finger protein DOF5.4-like [Lupinus angustifolius] gb|OIW18535.1| hypothetical protein TanjilG_13287 [Lupinus angustifolius] Length = 305 Score = 98.2 bits (243), Expect = 2e-22 Identities = 44/68 (64%), Positives = 45/68 (66%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR + Sbjct: 56 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRANSNSITKPSNNNSSSETP 115 Query: 182 PEHKSNSH 205 PEH SNSH Sbjct: 116 PEHNSNSH 123 >gb|PNX74758.1| dof zinc finger protein [Trifolium pratense] Length = 306 Score = 98.2 bits (243), Expect = 2e-22 Identities = 46/69 (66%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXA-LPTP 178 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR + LP Sbjct: 54 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSTKPKNSSSSSEISTLPMT 113 Query: 179 TPEHKSNSH 205 PE+KSNSH Sbjct: 114 PPENKSNSH 122 >gb|OIW19680.1| hypothetical protein TanjilG_18490 [Lupinus angustifolius] Length = 293 Score = 97.8 bits (242), Expect = 2e-22 Identities = 44/68 (64%), Positives = 46/68 (67%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRN+PVGGGCR + P Sbjct: 39 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNIPVGGGCRKSKRSNHNNNNDNSSETEITAP- 97 Query: 182 PEHKSNSH 205 PEH SNSH Sbjct: 98 PEHNSNSH 105 >ref|XP_019439011.1| PREDICTED: dof zinc finger protein DOF5.4-like [Lupinus angustifolius] Length = 299 Score = 97.8 bits (242), Expect = 3e-22 Identities = 44/68 (64%), Positives = 46/68 (67%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRN+PVGGGCR + P Sbjct: 45 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNIPVGGGCRKSKRSNHNNNNDNSSETEITAP- 103 Query: 182 PEHKSNSH 205 PEH SNSH Sbjct: 104 PEHNSNSH 111 >gb|PON46427.1| Zinc finger, Dof-type [Parasponia andersonii] Length = 341 Score = 95.1 bits (235), Expect = 5e-21 Identities = 43/68 (63%), Positives = 45/68 (66%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR A + Sbjct: 54 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSKPKAALSAPAAVATAPAS 113 Query: 182 PEHKSNSH 205 + KSNSH Sbjct: 114 QDRKSNSH 121 >ref|NP_001236530.2| Dof4 [Glycine max] gb|KRH03180.1| hypothetical protein GLYMA_17G081800 [Glycine max] Length = 300 Score = 94.4 bits (233), Expect = 6e-21 Identities = 43/69 (62%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR + P P Sbjct: 47 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPNKITPSETASPPPPP 106 Query: 182 -PEHKSNSH 205 P+H +NS+ Sbjct: 107 HPDHNNNSN 115 >gb|ABI16005.1| Dof4 [Glycine max] Length = 300 Score = 94.4 bits (233), Expect = 6e-21 Identities = 43/69 (62%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR + P P Sbjct: 47 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPNKITPSETASPPPPP 106 Query: 182 -PEHKSNSH 205 P+H +NS+ Sbjct: 107 HPDHNNNSN 115 >ref|XP_004508651.1| PREDICTED: dof zinc finger protein DOF5.4 [Cicer arietinum] Length = 307 Score = 94.4 bits (233), Expect = 6e-21 Identities = 47/71 (66%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR-XXXXXXXXXXXXXXXXXALP-- 172 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR ALP Sbjct: 50 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPKNSSSSSETTALPGT 109 Query: 173 TPTPEHKSNSH 205 P E+KSNSH Sbjct: 110 PPETENKSNSH 120 >ref|XP_010101639.1| dof zinc finger protein DOF5.4 [Morus notabilis] gb|EXB89108.1| Dof zinc finger protein [Morus notabilis] Length = 342 Score = 94.7 bits (234), Expect = 7e-21 Identities = 45/74 (60%), Positives = 47/74 (63%), Gaps = 6/74 (8%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXAL---- 169 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR A Sbjct: 50 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSKPKASSATSAVAATANST 109 Query: 170 --PTPTPEHKSNSH 205 P P+ + KSNSH Sbjct: 110 PPPPPSQDRKSNSH 123 >gb|AEZ49193.1| dof-type zinc finger protein, partial [Sorghum bicolor] Length = 83 Score = 88.6 bits (218), Expect = 8e-21 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR 112 YYNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCR Sbjct: 45 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCR 81 >gb|EPS60475.1| hypothetical protein M569_14328, partial [Genlisea aurea] Length = 91 Score = 88.6 bits (218), Expect = 9e-21 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR 112 YYNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCR Sbjct: 51 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCR 87 >ref|XP_015883277.1| PREDICTED: dof zinc finger protein DOF5.4 [Ziziphus jujuba] Length = 318 Score = 93.6 bits (231), Expect = 1e-20 Identities = 44/69 (63%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCR + P P Sbjct: 47 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSKPKASSATTSTPSPPPPV 106 Query: 182 P-EHKSNSH 205 E KSNSH Sbjct: 107 ALERKSNSH 115 >gb|AJG01743.1| Dof25, partial [Cajanus cajan] Length = 186 Score = 90.5 bits (223), Expect = 2e-20 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR 112 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR Sbjct: 24 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR 60 >ref|XP_022987278.1| dof zinc finger protein DOF5.4-like [Cucurbita maxima] Length = 318 Score = 93.2 bits (230), Expect = 2e-20 Identities = 44/71 (61%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCR P P Sbjct: 49 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSSSSSKSTPDVATTSPPPP 108 Query: 182 P---EHKSNSH 205 P E KS SH Sbjct: 109 PPLRERKSTSH 119 >ref|XP_021809971.1| dof zinc finger protein DOF5.4 [Prunus avium] Length = 327 Score = 92.8 bits (229), Expect = 3e-20 Identities = 43/71 (60%), Positives = 47/71 (66%), Gaps = 3/71 (4%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTP- 178 YYNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCR P P Sbjct: 50 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSKPKSSSSSSPPPPPPQPN 109 Query: 179 --TPEHKSNSH 205 T +HK++SH Sbjct: 110 SATDQHKASSH 120 >ref|XP_017430102.1| PREDICTED: dof zinc finger protein DOF5.4 isoform X1 [Vigna angularis] ref|XP_017430190.1| PREDICTED: dof zinc finger protein DOF5.4 isoform X2 [Vigna angularis] dbj|BAT76493.1| hypothetical protein VIGAN_01450700 [Vigna angularis var. angularis] Length = 285 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 44/66 (66%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR P P Sbjct: 55 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSDAAPPP-PPPD 113 Query: 182 PEHKSN 199 P+H S+ Sbjct: 114 PDHSSS 119 >ref|XP_014506030.1| dof zinc finger protein DOF5.4-like [Vigna radiata var. radiata] Length = 286 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 44/66 (66%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR P P Sbjct: 56 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSDAVPPP-PPPD 114 Query: 182 PEHKSN 199 P+H S+ Sbjct: 115 PDHSSS 120 >ref|XP_007155202.1| hypothetical protein PHAVU_003G182100g [Phaseolus vulgaris] gb|ESW27196.1| hypothetical protein PHAVU_003G182100g [Phaseolus vulgaris] Length = 287 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 44/66 (66%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCR P P Sbjct: 57 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSDTAPPP-PLPD 115 Query: 182 PEHKSN 199 P+H S+ Sbjct: 116 PDHSSS 121 >ref|XP_013618360.1| PREDICTED: dof zinc finger protein DOF5.4-like [Brassica oleracea var. oleracea] Length = 282 Score = 91.3 bits (225), Expect = 6e-20 Identities = 42/67 (62%), Positives = 43/67 (64%) Frame = +2 Query: 2 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRXXXXXXXXXXXXXXXXXALPTPT 181 YYNNYNLSQPRHFCKNCRRYWTKGGVLR VPVGGGCR PT Sbjct: 58 YYNNYNLSQPRHFCKNCRRYWTKGGVLRKVPVGGGCRKAKRSKPKQDQPPSSADKQPTQE 117 Query: 182 PEHKSNS 202 E KS+S Sbjct: 118 AEEKSSS 124