BLASTX nr result
ID: Astragalus22_contig00009933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009933 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU13178.1| unknown, partial [Glycine max] 57 4e-07 ref|XP_019445211.1| PREDICTED: 60S ribosomal protein L13-1-like ... 55 9e-07 gb|ACU14254.1| unknown [Glycine max] 54 9e-07 gb|PNX81666.1| 60S ribosomal protein l13, partial [Trifolium pra... 54 1e-06 ref|NP_001276322.2| 60S ribosomal protein L13-1-like [Glycine ma... 55 2e-06 gb|ACU23653.1| unknown [Glycine max] 55 2e-06 gb|ACU14467.1| unknown [Glycine max] 55 2e-06 ref|XP_020212167.1| 60S ribosomal protein L13-1-like [Cajanus ca... 54 2e-06 ref|XP_014519879.1| 60S ribosomal protein L13-1 [Vigna radiata v... 54 2e-06 gb|KHN27522.1| 60S ribosomal protein L13-2 [Glycine soja] 54 2e-06 ref|NP_001238240.2| 60S ribosomal protein L13 [Glycine max] >gi|... 54 2e-06 ref|XP_004512381.1| PREDICTED: 60S ribosomal protein L13-1-like ... 54 2e-06 ref|XP_004499145.1| PREDICTED: 60S ribosomal protein L13-1 [Cice... 54 2e-06 ref|XP_003626151.2| 60S ribosomal L13-like protein [Medicago tru... 54 3e-06 gb|PNX71943.1| 60S ribosomal protein l13-1 [Trifolium pratense] 54 3e-06 ref|XP_003612594.2| 60S ribosomal L13-like protein [Medicago tru... 54 3e-06 gb|AFK40501.1| unknown [Medicago truncatula] 54 3e-06 gb|AFK36916.1| unknown [Medicago truncatula] 54 3e-06 dbj|GAU15831.1| hypothetical protein TSUD_236470 [Trifolium subt... 54 3e-06 dbj|GAU33308.1| hypothetical protein TSUD_165730 [Trifolium subt... 54 3e-06 >gb|ACU13178.1| unknown, partial [Glycine max] Length = 258 Score = 57.0 bits (136), Expect = 4e-07 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = +3 Query: 183 AKTVLQ*LLQD---GFRTLGSSLFVFLLCFGSLLQSGTLVAFVCAFKAKLVISFERLHFI 353 AK V Q LL R L F L CF S LQSGT++AFVCAFK KLVISF+ LH I Sbjct: 14 AKIVSQQLLYGWTTNVRLLKVITFCLLFCFSSFLQSGTMMAFVCAFKTKLVISFKCLHVI 73 >ref|XP_019445211.1| PREDICTED: 60S ribosomal protein L13-1-like [Lupinus angustifolius] gb|OIW10728.1| hypothetical protein TanjilG_27674 [Lupinus angustifolius] Length = 207 Score = 55.5 bits (132), Expect = 9e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DE+KAFKAYYKLRLERTNKRHQGARL Sbjct: 170 DELKAFKAYYKLRLERTNKRHQGARL 195 >gb|ACU14254.1| unknown [Glycine max] Length = 141 Score = 54.3 bits (129), Expect = 9e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 104 DEMKAFKAYYKLRLERTNKRHYGARL 129 >gb|PNX81666.1| 60S ribosomal protein l13, partial [Trifolium pratense] Length = 126 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 89 DEMKAFKAYYKLRLERTNKRHLGARL 114 >ref|NP_001276322.2| 60S ribosomal protein L13-1-like [Glycine max] gb|KHM99443.1| 60S ribosomal protein L13-2 [Glycine soja] gb|KRH07719.1| hypothetical protein GLYMA_16G106300 [Glycine max] Length = 207 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHHGARL 195 >gb|ACU23653.1| unknown [Glycine max] Length = 207 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHHGARL 195 >gb|ACU14467.1| unknown [Glycine max] Length = 231 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHHGARL 195 >ref|XP_020212167.1| 60S ribosomal protein L13-1-like [Cajanus cajan] gb|KYP71438.1| 60S ribosomal protein L13-1 [Cajanus cajan] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >ref|XP_014519879.1| 60S ribosomal protein L13-1 [Vigna radiata var. radiata] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >gb|KHN27522.1| 60S ribosomal protein L13-2 [Glycine soja] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >ref|NP_001238240.2| 60S ribosomal protein L13 [Glycine max] gb|KRH07204.1| hypothetical protein GLYMA_16G074600 [Glycine max] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >ref|XP_004512381.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >ref|XP_004499145.1| PREDICTED: 60S ribosomal protein L13-1 [Cicer arietinum] Length = 207 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHYGARL 195 >ref|XP_003626151.2| 60S ribosomal L13-like protein [Medicago truncatula] gb|AES82369.2| 60S ribosomal L13-like protein [Medicago truncatula] Length = 205 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 168 DEMKAFKAYYKLRLERTNKRHLGARL 193 >gb|PNX71943.1| 60S ribosomal protein l13-1 [Trifolium pratense] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195 >ref|XP_003612594.2| 60S ribosomal L13-like protein [Medicago truncatula] gb|AFK45847.1| unknown [Medicago truncatula] gb|AES95552.2| 60S ribosomal L13-like protein [Medicago truncatula] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195 >gb|AFK40501.1| unknown [Medicago truncatula] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195 >gb|AFK36916.1| unknown [Medicago truncatula] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195 >dbj|GAU15831.1| hypothetical protein TSUD_236470 [Trifolium subterraneum] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195 >dbj|GAU33308.1| hypothetical protein TSUD_165730 [Trifolium subterraneum] Length = 207 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 353 DEMKAFKAYYKLRLERTNKRHQGARL 276 DEMKAFKAYYKLRLERTNKRH GARL Sbjct: 170 DEMKAFKAYYKLRLERTNKRHLGARL 195