BLASTX nr result
ID: Astragalus22_contig00009833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009833 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX81142.1| MYB-like transcription factor family protein, par... 57 4e-07 dbj|GAU13546.1| hypothetical protein TSUD_346500 [Trifolium subt... 57 7e-07 ref|XP_013450552.1| myb-like transcription factor family protein... 54 6e-06 >gb|PNX81142.1| MYB-like transcription factor family protein, partial [Trifolium pratense] Length = 246 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 KEMVDEAEVSNEHERVGDQFASAPPTKRVKVQ 97 KEMVDEAEV+NEHERV DQF+ PPTKR K+Q Sbjct: 215 KEMVDEAEVTNEHERVDDQFSDVPPTKRAKIQ 246 >dbj|GAU13546.1| hypothetical protein TSUD_346500 [Trifolium subterraneum] Length = 430 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 KEMVDEAEVSNEHERVGDQFASAPPTKRVKVQ 97 KEMVDEAEV+NEHERV DQF+ PPTKR K+Q Sbjct: 399 KEMVDEAEVTNEHERVDDQFSDVPPTKRAKIQ 430 >ref|XP_013450552.1| myb-like transcription factor family protein [Medicago truncatula] gb|KEH24580.1| myb-like transcription factor family protein [Medicago truncatula] Length = 441 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 KEMVDEAEVSNEHERVGDQFASAPPTKRVKVQ 97 K+M DEAEV+NEHERV DQF+ PPTKR K+Q Sbjct: 410 KQMADEAEVTNEHERVDDQFSDVPPTKRAKIQ 441