BLASTX nr result
ID: Astragalus22_contig00009623
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00009623 (323 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY12906.1| pyruvate kinase family protein [Trifolium pratense] 113 3e-27 ref|XP_004495407.1| PREDICTED: pyruvate kinase isozyme A, chloro... 113 6e-27 ref|XP_013468767.1| pyruvate kinase family protein [Medicago tru... 113 6e-27 ref|XP_016175929.1| pyruvate kinase isozyme A, chloroplastic [Ar... 113 6e-27 dbj|GAU47652.1| hypothetical protein TSUD_27770 [Trifolium subte... 113 6e-27 ref|XP_015940565.1| pyruvate kinase isozyme A, chloroplastic [Ar... 113 6e-27 gb|PKI32629.1| hypothetical protein CRG98_046976 [Punica granatum] 110 2e-26 ref|XP_022572322.1| plastidial pyruvate kinase 1, chloroplastic ... 111 3e-26 ref|XP_009135839.1| PREDICTED: plastidial pyruvate kinase 1, chl... 111 3e-26 gb|KVH87607.1| Pyruvate kinase [Cynara cardunculus var. scolymus] 111 3e-26 ref|XP_018493148.1| PREDICTED: plastidial pyruvate kinase 1, chl... 111 3e-26 ref|XP_022016854.1| pyruvate kinase isozyme A, chloroplastic-lik... 111 3e-26 ref|XP_022010861.1| pyruvate kinase isozyme A, chloroplastic-lik... 111 3e-26 ref|XP_023740527.1| pyruvate kinase isozyme A, chloroplastic [La... 111 3e-26 ref|XP_009388479.1| PREDICTED: pyruvate kinase isozyme A, chloro... 111 3e-26 ref|XP_013629662.1| PREDICTED: plastidial pyruvate kinase 1, chl... 111 3e-26 ref|XP_010107738.1| pyruvate kinase isozyme A, chloroplastic [Mo... 111 3e-26 ref|XP_019576180.1| PREDICTED: plastidial pyruvate kinase 1, chl... 111 3e-26 ref|NP_566720.1| Pyruvate kinase family protein [Arabidopsis tha... 111 3e-26 ref|XP_010488330.1| PREDICTED: plastidial pyruvate kinase 1, chl... 111 3e-26 >gb|PNY12906.1| pyruvate kinase family protein [Trifolium pratense] Length = 443 Score = 113 bits (282), Expect = 3e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 219 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 273 >ref|XP_004495407.1| PREDICTED: pyruvate kinase isozyme A, chloroplastic [Cicer arietinum] Length = 569 Score = 113 bits (282), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 216 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 270 >ref|XP_013468767.1| pyruvate kinase family protein [Medicago truncatula] gb|KEH42804.1| pyruvate kinase family protein [Medicago truncatula] Length = 570 Score = 113 bits (282), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 217 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 271 >ref|XP_016175929.1| pyruvate kinase isozyme A, chloroplastic [Arachis ipaensis] Length = 572 Score = 113 bits (282), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 219 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 273 >dbj|GAU47652.1| hypothetical protein TSUD_27770 [Trifolium subterraneum] Length = 573 Score = 113 bits (282), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 220 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 274 >ref|XP_015940565.1| pyruvate kinase isozyme A, chloroplastic [Arachis duranensis] Length = 576 Score = 113 bits (282), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 223 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 277 >gb|PKI32629.1| hypothetical protein CRG98_046976 [Punica granatum] Length = 454 Score = 110 bits (276), Expect = 2e-26 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKC CTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD Sbjct: 101 GGMVRFEVIEKIGPDVKCRCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 155 >ref|XP_022572322.1| plastidial pyruvate kinase 1, chloroplastic [Brassica napus] Length = 565 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 212 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 266 >ref|XP_009135839.1| PREDICTED: plastidial pyruvate kinase 1, chloroplastic [Brassica rapa] Length = 565 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 212 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 266 >gb|KVH87607.1| Pyruvate kinase [Cynara cardunculus var. scolymus] Length = 569 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 229 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 283 >ref|XP_018493148.1| PREDICTED: plastidial pyruvate kinase 1, chloroplastic [Raphanus sativus] Length = 571 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 218 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 272 >ref|XP_022016854.1| pyruvate kinase isozyme A, chloroplastic-like [Helianthus annuus] gb|OTF91776.1| putative pyruvate kinase isozyme A protein [Helianthus annuus] Length = 573 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 220 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 274 >ref|XP_022010861.1| pyruvate kinase isozyme A, chloroplastic-like [Helianthus annuus] gb|OTF94139.1| putative plastidic pyruvate kinase [Helianthus annuus] Length = 580 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 227 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 281 >ref|XP_023740527.1| pyruvate kinase isozyme A, chloroplastic [Lactuca sativa] gb|PLY68659.1| hypothetical protein LSAT_5X68180 [Lactuca sativa] Length = 584 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 231 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 285 >ref|XP_009388479.1| PREDICTED: pyruvate kinase isozyme A, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 585 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 232 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 286 >ref|XP_013629662.1| PREDICTED: plastidial pyruvate kinase 1, chloroplastic [Brassica oleracea var. oleracea] Length = 586 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 233 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 287 >ref|XP_010107738.1| pyruvate kinase isozyme A, chloroplastic [Morus notabilis] gb|EXC16773.1| Pyruvate kinase isozyme A [Morus notabilis] Length = 587 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 234 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 288 >ref|XP_019576180.1| PREDICTED: plastidial pyruvate kinase 1, chloroplastic [Rhinolophus sinicus] Length = 591 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 238 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 292 >ref|NP_566720.1| Pyruvate kinase family protein [Arabidopsis thaliana] sp|Q9LIK0.1|PKP1_ARATH RecName: Full=Plastidial pyruvate kinase 1, chloroplastic; Short=PK1; Short=PKp1; AltName: Full=Pyruvate kinase II; AltName: Full=Pyruvate kinase isozyme A; Short=PKP-ALPHA; Flags: Precursor dbj|BAB03043.1| pyruvate kinase [Arabidopsis thaliana] gb|AAL10484.1| AT3g22960/F5N5_15 [Arabidopsis thaliana] gb|AAL24192.1| AT3g22960/F5N5_15 [Arabidopsis thaliana] gb|AAN86162.1| putative pyruvate kinase [Arabidopsis thaliana] gb|AEE76697.1| Pyruvate kinase family protein [Arabidopsis thaliana] Length = 596 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 243 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 297 >ref|XP_010488330.1| PREDICTED: plastidial pyruvate kinase 1, chloroplastic [Camelina sativa] Length = 596 Score = 111 bits (277), Expect = 3e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +1 Query: 157 GGMVWFEVIEKVGPDVKCLCTDPGLLLPRANLTFWRNGSLVRERNAMLPTISSKD 321 GGMV FEVIEK+GPDVKCLCTDPGLLLPRANLTFWR+GSLVRERNAMLPTISSKD Sbjct: 243 GGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKD 297